SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020702 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020702
Domain Number 1 Region: 11-122
Classification Level Classification E-value
Superfamily Immunoglobulin 5.82e-19
Family V set domains (antibody variable domain-like) 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020702   Gene: ENSECAG00000023275   Transcript: ENSECAT00000024897
Sequence length 264
Comment pep:known_by_projection chromosome:EquCab2:6:27056572:27059423:-1 gene:ENSECAG00000023275 transcript:ENSECAT00000024897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDSPDRPWRPLTFSPARLMVPEGANATFTCSFSNTSEHFVLNWYRMSPSNQTDKLAAFPE
DSSQPGRSGRFRVTRLPNGRDFHMSVLAARRNDSGIYLCGAISLPPKTQINESPRAELTV
TERIPEPPTEHPSPPPSPAGQLQGLVVGITSLLVGVLLVLLLACVLTTTFPRAARDGTFG
RRVGAWVKEGPSAPPAFSVDYGELDFQWREKTPEPPAPCVPEQTEYATIVFPGRPGSQGR
RASADDPQGPRPLRPEDGHCSWPL
Download sequence
Identical sequences F6U6N6
ENSECAP00000020702 9796.ENSECAP00000020702 ENSECAP00000020702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]