SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020712 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020712
Domain Number 1 Region: 20-120
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-25
Family PDZ domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020712   Gene: ENSECAG00000023295   Transcript: ENSECAT00000024908
Sequence length 229
Comment pep:known_by_projection chromosome:EquCab2:X:39607426:39608988:1 gene:ENSECAG00000023295 transcript:ENSECAT00000024908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGTCTTPSQVTQGKARCTSKLPQASGQFCVELARGSTGFGLTLSGGRDAAGDTPLAVRGL
LKDGPAERCGHLQAGDLVLLINGETTQGLTHAQVVERIRGGGPRLRLVLSRPLETHPSKP
ERVGRPRKGHVLPSPDRSPDPGRPEVMRSHSASPSLFQHPRSHTTPKTRGSPEPSLERAA
DSSAVSPDDRTPGSPGPWLVPSEERLSRALGVPGAAQLALEMAAGRRRH
Download sequence
Identical sequences F6U655
9796.ENSECAP00000020712 ENSECAP00000020712 ENSECAP00000020712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]