SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000020874 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000020874
Domain Number 1 Region: 44-239
Classification Level Classification E-value
Superfamily p53-like transcription factors 9.32e-75
Family T-box 0.000000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000020874   Gene: ENSECAG00000023325   Transcript: ENSECAT00000025103
Sequence length 534
Comment pep:novel chromosome:EquCab2:5:50433744:50479498:1 gene:ENSECAG00000023325 transcript:ENSECAT00000025103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSEQSTGSDSEVLTERTSCSFDTHTDLGPGAAGPVPAALSSMEEIQVELQCADLWKRFHD
IGTEMIITKAGRRMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNA
DSPVPPRVYIHPDSLASGDTWMRQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIR
KDFSSDLSPTKPVPVGDGVKTFNFPETVFTTVTAYQNQQITRLKIDRNPFAKGFRDSGRN
RTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPTTSSTGTPSPSASSHLLSP
SCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSGYNRLQSGA
TSATQPSETFMPQRTPSLISGIPTPPSLPSNSKMEAYGGQLGSFPTSQFQYVMQAGNAAS
SSSSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSTSQSTLLCSSPS
NGAFGERQYLPTGMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVHMV
Download sequence
Identical sequences F6VPR5
ENSECAP00000020874 9796.ENSECAP00000020874 ENSECAP00000020874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]