SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021075 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021075
Domain Number 1 Region: 316-564
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.24e-98
Family STAT DNA-binding domain 0.0000000418
Further Details:      
 
Domain Number 2 Region: 136-316
Classification Level Classification E-value
Superfamily STAT 4.12e-59
Family STAT 0.00000957
Further Details:      
 
Domain Number 3 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 8.37e-44
Family Transcription factor STAT-4 N-domain 0.000000401
Further Details:      
 
Domain Number 4 Region: 565-701
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-43
Family SH2 domain 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021075   Gene: ENSECAG00000023170   Transcript: ENSECAT00000025335
Sequence length 748
Comment pep:known_by_projection chromosome:EquCab2:18:67349714:67441797:-1 gene:ENSECAG00000023170 transcript:ENSECAT00000025335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAAANNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPIQGPLEKSLQSSSVSERQRNVEHKVTAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQP
MDQGDKNSALMNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNNMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRAHL
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSIEESSNGSLSVEFRHLQPKEMKSSTGNKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSATLSQLLEVMSWQFSSYVGRGLNSDQLNMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPQSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
Download sequence
Identical sequences F7CJM0
9796.ENSECAP00000021075 ENSECAP00000021075 XP_005601705.1.31192 XP_005601706.1.31192 ENSECAP00000021075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]