SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021100 from Equus caballus 76_2

(show help)
Strong hits

Sequence:	ENSECAP00000021100
Domain Number 1	Region: 29-119
Classification Level	Classification	E-value
Superfamily	Retrovirus capsid dimerization domain-like	5.95e-36
Family	SCAN domain	0.0000675
Further Details:

Domain Number 2	Region: 294-350
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	4.78e-22
Family	Classic zinc finger, C2H2	0.008
Further Details:

Domain Number 3	Region: 125-172
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	6.15e-20
Family	KRAB domain (Kruppel-associated box)	0.0011
Further Details:

Domain Number 4	Region: 255-307
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	7.57e-20
Family	Classic zinc finger, C2H2	0.0073
Further Details:

Domain Number 5	Region: 335-387
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	5.71e-19
Family	Classic zinc finger, C2H2	0.0037
Further Details:

Weak hits

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSECAP00000021100 Gene: ENSECAG00000023652 Transcript: ENSECAT00000025365
Sequence length	392
Comment	pep:novel chromosome:EquCab2:13:39474211:39481566:-1 gene:ENSECAG00000023652 transcript:ENSECAT00000025365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	PQIRALWETKGSVTESSSQSKKYTSQMDSLSPEISRQHFRNFHYDEAAGPHEAVSQLQEL CSQWLRPEIHSKEKILELLVLEQFLTILPRDIQTGVKKHHLQGIEEAVALVEHLQKESGQ TRNGSLLTFEEVAMYFSQEEWELLDPTQKALYNDVMQENYETLISLGLKLKNNTENQQPV CLSDLEIQAPGDIVSKKTRVRVPQKTTGKENHGDTHRVGKWHQDFPVKKRKKLSTWKQEL LKLMDLHKKERAAEKPFKCQECGKSFRVSSDLIKHQRIHTEEKPYKCQQCDKRFRWSSDL NKHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHR RTHTGEQPYTCSICRRNFSRRSSLLRHQKLHQ
Download sequence
Identical sequences	F7C8L0 ENSECAP00000021100

SEARCH