SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021237 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021237
Domain Number 1 Region: 45-469
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.05e-104
Family L-arabinose binding protein-like 0.0000000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021237   Gene: ENSECAG00000023504   Transcript: ENSECAT00000025528
Sequence length 826
Comment pep:known_by_projection chromosome:EquCab2:14:3413729:3425590:1 gene:ENSECAG00000023504 transcript:ENSECAT00000025528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVRLAGGLTLGGLFQVHARGRRTGRAEPFKKEQGVHSLESMLALDRNSDPELLTGVRLGA
RMLDTCSRNNVRLRGDAVYAAAATGDEAAVCCPGGGPPLLAAPPERVVAVVGASASSVSI
MVANVLRLFAIPQISYASTAPELSDSTRYDFFSRVVPPDSYQAQAMVDIVRALGWNYVST
LASEGNYGESGVEAFVQISREAGGVCIAQSIKIPREPKPGEFSKVIRRLMETPNARGIII
FANEDDIRRVLEAARQANLTGHFLWVGSDSWGAKVSPVLNLEDVAVGAITILPKRASIDG
FDQYFMSRSLENNRRNIWFAEFWEENFNCKLTGSGTLSDDSTRKCTGEERIGRDSTYEQE
GKVQFVIDAVYAIAHALHSMQQDLCPGHTGLCPAMEPTDGRTLLQYIRAVRFNGDAGTPV
MFNENGDAPGRYDIFQYQAANGSAGSGGYQTVGQWAEDLRLDVEALQWSGDPHEVPQSQC
SLPCGPGERKKMVKGVPCCWHCEACDGYRFQVDEFTCEACPRDMRPTRNHTGCRPTPVTL
TWSSPWAAPPLLLAVLGIVATTTVVATFMRHNNTPIVRASGRELSYVLLTGIFLIYAITF
LMVAEPGAAVCAARRLLLGLGTTLSYSALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLV
ITFSLTFVQVVGVIAWLGAQPPHSVIDYEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSF
LLMVTCTVYAIKARGVPETFNEAKPIGFTMYTTCIVWLAFVPIFFGTAQSAEKIYIQTTT
LTVSLSLSASVSLGMLYVPKTYVILFHPEQNVQKRKRSLKTTSTVA
Download sequence
Identical sequences F6YNA0
ENSECAP00000021237 ENSECAP00000021237 9796.ENSECAP00000021237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]