SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021262 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021262
Domain Number 1 Region: 5-100
Classification Level Classification E-value
Superfamily Fibronectin type III 5.25e-28
Family Fibronectin type III 0.00039
Further Details:      
 
Domain Number 2 Region: 102-207
Classification Level Classification E-value
Superfamily Fibronectin type III 3.89e-18
Family Fibronectin type III 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021262   Gene: ENSECAG00000023854   Transcript: ENSECAT00000025557
Sequence length 277
Comment pep:known_by_projection chromosome:EquCab2:21:3205181:3209201:-1 gene:ENSECAG00000023854 transcript:ENSECAT00000025557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPEKPFNISCWSKNMKDLTCRWTPGAQGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGP
HSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQ
LSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVR
CNPFGIYGSKKAGIWSEWSHPTAASTPRSVRPIGGACEPRGGEPSSGPVRRELKQFLGWL
KKHAYCSNLSFRLYDQWRAWMQKSHKTRNQVGRRDRR
Download sequence
Identical sequences F6YMR8
ENSECAP00000021262 ENSECAP00000021262 9796.ENSECAP00000021262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]