SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021386 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021386
Domain Number 1 Region: 233-296
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 2 Region: 360-420
Classification Level Classification E-value
Superfamily BPTI-like 1.04e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0057
Further Details:      
 
Domain Number 3 Region: 311-349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000458
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021386   Gene: ENSECAG00000023874   Transcript: ENSECAT00000025692
Sequence length 508
Comment pep:known_by_projection chromosome:EquCab2:1:147751378:147762181:-1 gene:ENSECAG00000023874 transcript:ENSECAT00000025692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAHLSQALIPAVLVWLLCELGLRGTQAGQPPEPPGLPAGPACLDRFTAGVPDFVLDTE
ASVSNGATFLGSPTVRRGWDCVRACCTTQNCNLALVELHSDGGEDAIATCFLMDCLYEQN
FVCKFAPREGFINYLTREVYRSYRELRTQGFGGSGIPRIWAGVDLKVQPQEPLVLKGVGT
TDWHLLQGDTDVRVEKNDLDQVELWGLKEGAYLFQLRAGSDQPDSTTNITITVLSAKQTE
EYCLASSKVGRCRGSFPRWYYDPTEQICKSFVYGGCLGNKNNYLREEECKLACRDVQGPS
VERHHPVCSGTCPSTKFRCSDGCCIDSFLECDDTPDCPDASDEATCDKYTSGFEELQNIH
FRSDKGHCVDLPDTGLCLESIPRWYYNPFSERCARFTYGGCYGNKNNFEEEQQCLESCRG
ISKKDVFGLRRESHIPSVGSVEVAVAVLLVTCIVVVVAILGYCFIKNQRKSFHRHHHRRP
PPPTPTSSTVSTTEDTEHLVYNHTTRPL
Download sequence
Identical sequences F6XWR7
ENSECAP00000021386 9796.ENSECAP00000021386 ENSECAP00000021386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]