SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021415 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021415
Domain Number 1 Region: 220-418
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.67e-49
Family Reprolysin-like 0.00018
Further Details:      
 
Domain Number 2 Region: 435-511
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.81e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000021415
Domain Number - Region: 666-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021415   Gene: ENSECAG00000023662   Transcript: ENSECAT00000025727
Sequence length 751
Comment pep:known_by_projection chromosome:EquCab2:11:18877062:18894100:-1 gene:ENSECAG00000023662 transcript:ENSECAT00000025727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPGLGIRGPAGALRWRVSPQLGVSEAPEVTEPSRLLQKSSGGEVRKQQLDTRVRQEPPGG
PPAHLAQVSFVIPAFNSDFTLDLELNHHLLSSQYVERHFSREGTTQHSTGAGDHCYYQGQ
LRGNPRSFAALSTCQGLHGVFSDGNFTYVVEPREMARPQEAPQGPLPHLIYRTPLLPAPL
GCREPGCLFTAPAHSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQS
VVLTSNFAKSVVNLADVMYKEQLNTRIVLVAMETWADGDKIQVQDDLLETLARLMVYRRE
GLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSRGGGVNEYDNMGAMAVTLAQTLGQNL
GMMWNKHRSSAGDCKCPDNWLGCIMEDTGFYLPRKFSRCSIDEYNQFLQEGGGSCLFNKP
LKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTLTHDAMCSDGLCCRRCKYEP
RGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQGRCYGGRCKTRDQQCQALW
GHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCNKQDVLCGFLLCVNISGAPRLGDLGGD
ISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNMLCLDHRCLPASAFNFSTCP
GSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSPPTGETERYKGPSGTNIIIG
SIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences F6WML4
ENSECAP00000021415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]