SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021426 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021426
Domain Number 1 Region: 1286-1448
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-70
Family Pleckstrin-homology domain (PH domain) 0.00000362
Further Details:      
 
Domain Number 2 Region: 1078-1289
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-53
Family DBL homology domain (DH-domain) 0.000000103
Further Details:      
 
Domain Number 3 Region: 494-609
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-20
Family Pleckstrin-homology domain (PH domain) 0.0032
Further Details:      
 
Domain Number 4 Region: 851-962
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000186
Family PDZ domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021426   Gene: ENSECAG00000023722   Transcript: ENSECAT00000025740
Sequence length 1679
Comment pep:known_by_projection chromosome:EquCab2:31:12447023:12553786:-1 gene:ENSECAG00000023722 transcript:ENSECAT00000025740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSESQYTLQGSKNHSHTITGAKQKPCSLKIRSIHAKDDKSLHGWGHGGSGAGYKSRSL
ARSCLSHFKSNQPYASRLGGPTCKVSKGSVCSKHRTNASGSDFQGSNVASSSENGFHYVG
HEPADNHVPSRDCNGHLLNCYGRHESVASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNG
DHHSPGPPGDSGGPVQLLRYSPTLTPGADSPPSTRLSATDSHPRSSKGSSLSSESSWYDS
PWGHAGEVGEAEGPFLASGTPDPSLHGFPPRDAQKPFNQSSSLSSLRELYPAATLGSLSP
SAVRLSDEYIGAHASLSHRVSFASDIDVPSRVEHRDPGQYASFTLPCRKSKALTEDTSKK
DTLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNADMPGPSWASATLWSG
GSAQILSQRSESAHAIGSDPLRQNIYENFMQELEMSRTNTENVETSTETAESSSESLSSL
EQLDLLFEKEQGVVRKAGWLFFKPLVTLQKERKLELVARRKWKQYWVTLKGCTLLFYETY
GKNSTDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQATSQTDLENWVT
AIHSACASLFAKKRGKEDTIRLLKNQTKNLIQKIDMDSKMKKMAELQLSVVSDPKNRKAI
ENQIQQWEQNLEKFHMDLFRTRCYLASLQGGELPNPKSLLAAASRPSKLALGRLGVLSVS
SFHALVCSRDDSALRKRKLSLTQRGRNKKGIFSSLKGLDTLARKAKEKRPSITQVDELLH
LYGSTVDGVPQDNTWEIQTYIHFQDNQGVTVVIKPEHRVEDILTLACKMRQLEPSHYGLQ
LRKLVDENIECCIPAPYEYMQEQVYDEIEVFPLNVYHVQLTKTGSVSDFGFAVTAQVDEH
QRLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVCDLDLKRMEALFSEKSVGLTLIAW
PPDTKGTLCSSWSDSDLSSRDQKSLLPPPNQSQLLEEFLDNFKKNTTNDFSNVPDITTGL
KRSQTDGTLDQVSHKERMEQTFRSAEQIPVLCRSFNDTQTDSMEGPREGEEATPRPLARH
LSDADRLRKVIQELVDTEKSYVKDLSCLFDLYLEPLQNETFLTQDEMESLFGSLPEMLEF
QKVFLETLEDGISAASDFNLLETPSQFRKLLFSLGGSFLYYADHFKLYSGFCANHIKVQK
VLERAKTDKAFKAFLDARNPTKQHSSTLESFLIKPVQRVLKYPLLLKELVSLTDHESEEH
YHLTEALKAMEKVASHINEMQKLYEDYGTVFDQLVAEQSGAEKEVTELSMGELLMHSTVS
WLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHSSADLDPFKFRW
LIPISALQVRLGNTAGTENNSVWELIHTKSEIEGRPETIFQLCCSDNESKTNIVKVIRSI
LRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKNSSSSEWPSEPGKG
SSLDSDEGSLSSSTQSSSCHTAGSRQDALQHPHTGLADFSDHLIKESDILSDEDEDYHQI
VKQGSPTKDIEIQFQRLRISDGPDAQLPGQQPGTDGQPGGEQPRLVRGHFCAIKRKANST
KRDRGTLLKTQTRHQSLDSQSENASLDLNSVLEREFSVQSLTSVVNEECFYETESHGKS
Download sequence
Identical sequences F6WLW3
ENSECAP00000021426 9796.ENSECAP00000021426 ENSECAP00000021426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]