SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021654 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021654
Domain Number 1 Region: 2-331
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.62e-76
Family Pancreatic carboxypeptidases 0.00000101
Further Details:      
 
Domain Number 2 Region: 331-384
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000126
Family Carboxypeptidase regulatory domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021654   Gene: ENSECAG00000024087   Transcript: ENSECAT00000025993
Sequence length 384
Comment pep:known_by_projection chromosome:EquCab2:1:29693654:29714971:1 gene:ENSECAG00000024087 transcript:ENSECAT00000025993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTFRHHRYDDLVRTLYKVHNECPYITRVYSIGRSVKGRHLYVLEFSDNPGFHEPLEPEVK
YVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRIVRLVEDTRIHIMPSMNPDGYEVAAAQ
PANLWDLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKTAEKGSRVEPE
TRAVIQWIRSFNFVLSANLHGGAVVANYPYDKSLEHRVRGFRRTANTPTPDDKLFQKVCR
MAAYYSPSNTHLTHPKHSWNCGDYFPDGITNGASWYSLSRGMQDFNYLYTNCFEITLELS
CDKFPRQEELQREWLGNREALIQFLEQVHQGIKGMVVDENCNNLAEAVISVSGINHDVTS
GDHGDYFRLLLPGTYTVTATAPGF
Download sequence
Identical sequences F6WZA8
ENSECAP00000021654 ENSECAP00000021654 9796.ENSECAP00000021654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]