SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021818 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021818
Domain Number 1 Region: 1257-1366
Classification Level Classification E-value
Superfamily PH domain-like 2.44e-24
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 
Domain Number 2 Region: 38-135
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.21e-21
Family FHA domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000021818
Domain Number - Region: 762-895,1258-1278
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0126
Family BAR domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021818   Gene: ENSECAG00000024225   Transcript: ENSECAT00000026177
Sequence length 1377
Comment pep:known_by_projection chromosome:EquCab2:7:26426047:26468432:1 gene:ENSECAG00000024225 transcript:ENSECAT00000026177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTLNRSQVGPGFKTQAMVQKGPLDLIETGKGLKVQTDKPHLVSLGSGRLSTAITLLPLE
EGRTVIGSAARDISLQGPGLAPEHCYIENLRGTLTLYPCGNACTIDGLPVQQPTRLTQGC
MLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPGPAESESLVNGNHTPQPATRGP
SACASHSSLVSSIEKDLQEIMDSLVLEDPGAAGKKPAATSPLSPMANGGRYLLSPPVSPG
AMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPAPSLPPLVPARSSSYHLALQPPQ
SRPSGARSSESPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESPRLGGQLPVV
AISLSEYPASGARTQHTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFREPPGTERALTTS
PSRQLVGRTFSDGSATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRALSPIPARTTPD
PKLTREVAESPRPRRWAAHAASPEDFSLTLGARSRRTRSPSPTLGESLAPRKGSFSGRLS
PAYSLGSLTGASPRQSPRSQRKLSSGDLRVPVTRERKNSITEISDNEDDLLEYHRRQRQE
RLREQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGRRPSRGLAG
AIGASGRSNEEPGSATQRLWESVERSDEENLKEECSSTESTQQEHEDAPSTKLQGEVLAL
EEERAQVLGRVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQKAVDQL
QEKLVTLETGIQKERDKEAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSKAE
LLRSITKRKERLAVLDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTMLERRYHS
LTGGRPFPKTSSTLKEVTCSLGFGLELDSWLRTGQVGLGTWCPCTPPTGPPASPAHQVRG
DPRERSHVCASLSSYPLCVSLPYPLPGGPYSSRVASCRALPNRRPSRKSAEARLYGCGQL
CRRLKHWQDSWTWSCGGFREVGQQVIEEQRRRLAELKQKAAAEAQCQWDALHGAAPFPAG
PSGFPPLMHHSILHHLPAGRERGEEGEHAYDTLSLESSDSMETSISTGGNSACSPDNVSR
AAGIRGGPLDLERVMRETEAQKEDVTQTRSHGKSETKFLTGRKKRSRDKTRKAMTCHSAT
GQQWTKRGYSADSPLCSQARPLTRYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCR
GYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAK
KRFFSFTMVSESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN
Download sequence
Identical sequences F6XR97
ENSECAP00000021818 9796.ENSECAP00000021818 ENSECAP00000021818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]