SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021914 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021914
Domain Number 1 Region: 38-222
Classification Level Classification E-value
Superfamily p53-like transcription factors 6.34e-79
Family T-box 0.000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021914   Gene: ENSECAG00000024414   Transcript: ENSECAT00000026283
Sequence length 519
Comment pep:known_by_projection chromosome:EquCab2:11:34635880:34662642:-1 gene:ENSECAG00000024414 transcript:ENSECAT00000026283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APETSLTASGLSGAALGSPSGSVADVAAVAVAEQTIENIKVGLHEKELWKKFHEAGTEMI
ITKAGRRMFPSYKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRL
YVHPDSPATGAHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFG
SKNTAFCTHVFPETSFISVTSYQNHKITQLKIENNPFAKGFRGSDDSDLRVARLQSKEYP
VISKSIMRQRLVSTQLSAKPDVSPLHGTHQALQHYQYENGAHMQFAAAEPQDLPLNTFPA
QRDSSLFYHCLKRRDSGRHLDLPCKRSYLEAPSAVGEDHYFRSPPPYDQQMLSPSYCSEV
TPREACMYSGSGPEIAGVSGVDDLPPPPLSCNMWTSVSPYTSYSVQTMETVPYQSFPTHF
TATTMMPRLPAISAQSSQPPGNTHFSVYNQLSQSQVRERGPTASFPRERGLPAVCERKPP
SPHLNAANEFLYSQSFSLSREASLQYHSGMGTVENWTDG
Download sequence
Identical sequences F6WIB7
9796.ENSECAP00000021914 ENSECAP00000021914 ENSECAP00000021914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]