SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021922 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021922
Domain Number 1 Region: 494-645
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.08e-67
Family Ankyrin repeat 0.0000000472
Further Details:      
 
Domain Number 2 Region: 3-222,255-280
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-61
Family BAR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 372-490
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.4e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.000000829
Further Details:      
 
Domain Number 4 Region: 253-361
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-21
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 5 Region: 878-957
Classification Level Classification E-value
Superfamily SH3-domain 1.09e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021922   Gene: ENSECAG00000024278   Transcript: ENSECAT00000026291
Sequence length 959
Comment pep:known_by_projection chromosome:EquCab2:15:83960235:84076851:-1 gene:ENSECAG00000024278 transcript:ENSECAT00000026291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLYKMKKSVKAINISGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKEL
TALFKNLIQNMNNIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHA
KLHGMIRTEISGAEIAEEMEKERRLFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQC
NFFQDGLKAVESLKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDLQIR
QSTAYSLHQPQGNKEHGTERNGNLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAK
LNLLTCQVKTNPEEKKCFDLISHDRTYHFQAEDEQECHIWMSVLQNSKEEALNNAFKGDD
NTGENNIVQELTKEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGV
HYSRMQSLTLDVLGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPSPGSDMNARKDYITA
KYIERKYARKKHADNTAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETA
LHLAVRSVDRTSLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIE
IANESGETPLDIAKRLRHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEK
LQPSPSRREDRPISFYQLGSNQLQSNAASLARDAASLAKDKQRSFAPSILQNETYGAILS
GSPPPTQPAAPSTASAPPLPPRNIAKVQTASSANALWKTNSVSVDGVSRQRSSSDPPAVH
PPLPPLRVTSTNPLAPTPPPPVAKTPSVIEALSQQSKPPPSGGPLSKAPPPLPPQPPSRP
PQKRPAPGADKSTTLTNKGQPRGPVDLSATEALGPLSNTMAMQPPAPMPRKSQTTKLKPK
RVKALYNCVADNPDELTFSEGDVIIVDGEEDQEWWIGHIDGDPSRKGAFPVSFVHFIVD
Download sequence
Identical sequences F6WHN4
ENSECAP00000021922 9796.ENSECAP00000021922 ENSECAP00000021922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]