SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000021975 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000021975
Domain Number 1 Region: 1308-1416
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 613-727
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1818-1927
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 4 Region: 449-553
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 69-171
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 6 Region: 272-382
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 7 Region: 1131-1250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 1659-1755
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-27
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 9 Region: 964-1073
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 785-906
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 11 Region: 1990-2097
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 12 Region: 2170-2274
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-25
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1476-1591
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 14 Region: 2524-2592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 15 Region: 2880-2951
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.97e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 16 Region: 2764-2832
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.08e-17
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 17 Region: 2581-2648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.67e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 18 Region: 3062-3130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 19 Region: 2821-2891
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.42e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 209-281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000104
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 21 Region: 2940-3005
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000162
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 22 Region: 2466-2528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 23 Region: 1932-2000
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000607
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 24 Region: 5-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000202
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 25 Region: 1759-1822
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000031
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 2697-2757
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000001
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 27 Region: 2339-2406
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000175
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 28 Region: 733-793
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 29 Region: 1421-1489
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000243
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 30 Region: 1076-1139
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 31 Region: 2639-2707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 32 Region: 1248-1311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000351
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 33 Region: 387-449
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000431
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 34 Region: 2276-2343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000723
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 35 Region: 2102-2167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000175
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 1598-1661
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 37 Region: 558-626
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000473
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 38 Region: 2411-2476
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000751
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 3121-3179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000792
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 40 Region: 906-968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000985
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000021975   Gene: ENSECAG00000024035   Transcript: ENSECAT00000026351
Sequence length 3416
Comment pep:known_by_projection chromosome:EquCab2:2:23026710:23565432:1 gene:ENSECAG00000024035 transcript:ENSECAT00000026351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSHTCGNPGRLPNGVQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHSGSENSATWDFPL
PSCRADDACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTIALVFIDFQLEDGY
DFLEVTGTEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFSAQYQVKKQIELKS
RGVKLMPSKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCNEGY
DLQGSKRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCVW
IITALNPAKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTGTSVPDLIVSTNHQ
MWLLFQTDGSGSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFHHGDTLKFECQPAFEL
VGQKAITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILARPE
SRIHLAFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHS
TGKRGFNITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCI
LKEGSVVWNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKIT
FDRFKTEVNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGF
QLRYETITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFTCDSGYTLSDGEPLECEPNFQW
SRALPSCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLES
GHDYLLITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFSE
YDLEPCEEPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPR
CVAECGNSVTGTQGTLLSPNFPVNYSNNHECIYSIQTQPGKGIQLKARAFELSEGDVLKV
YDGNNNSARLLGVFSRSEMMGVTLNSTSSSLWLDFITDAQNTSKGFELQFSSFELIKCED
PGTPQFGYKVHDGGHFAGSSVSFSCDPGYSLRGSEALLCLSGERRTWDRPLPTCVAECGG
TVRGEVSGQVLSPGYPAPYEHNLNCIWTIEADAGCTIGLHFLVFDTEEVHDVLRIWDGPV
ESGVLLKELSGSALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSATSCNDPGVPQNGSR
SGDSWEAGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCTAPCGGDLTGPSGVI
LSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHIYDGPDSLSPLIGSFY
GSQLPGRIESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDPGSIKNGTRVGSDLKL
GSSITYYCHGGYEVEGSSTLSCILGPDGKPVWNNPRPVCTAPCGGQYVSSDGVVLSPNYP
QNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQHSRLLSSLSGSHTGES
LPLATSNQVLIKFSAKGQAPARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDFSVGAV
VRFECNSGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPEPY
LNSLNCVWKIMVPEGAGIQIQVISFVTEQNWDSLEVFDGTTVPALLNSTSNQLYLHFYSD
ISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVVSFQCEPGYALQGHAHISC
MPGTVRRWNYPPPLCIAQCGGVVEEMEGVILSPGFPGNYPSNMDCSWKIALPVGFGAHIQ
FLNFSTEPNHDFIEIRNGPYETSRVMGRFSGSELPGALLSTSHETTVYFHSDHSQNRPGF
KLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLIGHPVLTCQHGTNRNW
DHPLPKCEVPCGGNITSSNGTVYSPGFPSPYSSAQDCVWLITVPIGQGIRLNLSLLQTEP
SGDFITVWDGPQQTAPQLGVFTRSSAKKTVHSSSNQVLLKFHHDAAMGAIFAMAFSAYPL
TKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGSEILTCKLGTYLQFEGPPPIC
EVHCPTNELMTDSTGVILSQSYPGSYPQFQTCSWLVRVEPEFNISLTVEYFLSEKQFDEF
EIFDGPSGQSPLLKALSGNYSAPLIVTSSSNSVYLRWSSDHAYNRKGFKIRYSAPYCSLP
RAPLHGFLLGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYFLWSEAIPLCQALSC
GLPEAPKSGMVFGREYTVGTKAVYSCSEGYHLEAGAEATAECLETGIWSNRNVPPQCVPV
TCPDVSSISVEHGRWRLIFETQYQFQAQLMLICDPGYYYTGQRVIRCQANGKWSLGNSMP
TCQIISCGELPIPPNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRC
LAGHCGTPEPIVNGHINGENYNYRGSVVYQCNAGFRLIGMSVRICQQDHHWSGKTPFCVP
ITCGHPGNPINGLTQGNQFNLNDVVKFVCNPGYVAEGAARSQCLASGQWSDTLPTCRIIN
CTDPGHQENSIRQVHASGPHRFSYGTTVSYQCNHGFYVLGTPVLSCQGDGTWDRPRPQCL
LVSCGHPGSPPHSQMSGDSYTVGAVVRYSCTGKRTLVGNATRMCGLDGQWTGSLPHCSGT
SMGICGDPGIPAHGIRLGDSFAPGSLMRFSCEAGHALRGSSERTCQANGSWSGTQPECGV
ISCGNPGTPSNARVMFSDGLVFSSSIVYECREGYYATGLLSRHCSVNGTWTGSDPECIVI
NCGDPGIPANGLRLGNDFRYNKTVTYQCVPGYMMESHRVSVLSCTKDRTWNGTKPICKAI
MCKPPQLIPNGKVVGSDFMWGSSVTYACLEGYQLSLPAVLTCEGNGSWTGELPQCFRNPM
SIPGLISHRGPREARSRLLILVISHRCIPPGDLLENSPKKIIQVNNTWTLGSQPCTNPTL
TMCADPGMPQFGIQNNSQGYQVGSTVLFRCQKGYLLQGSTTRTCLPNLTWSGTPPDCVPH
HCKQPETPTHADVGALDLPSMGYTLIYSCQEGFSLKGGSEHRTCKADGSWTGKPPVCLAE
VRPSGRPINTAREPPLTQASVPGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQVVNSKVN
ATMIDHSGVELHLAGTYRKEDFHLLLQVYQTTGPVEIFVNKFKDDHWALDGHVSSESSGG
TFVYQGSVKGQGFGQFGFQRLGGSDPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYL
YKHRRRPKVPFNGYAGHENTNVRATFENPMYDRNIQPTDIMATEAEFTVSTVCTAV
Download sequence
Identical sequences F6YVA5
ENSECAP00000021975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]