SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022007 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022007
Domain Number 1 Region: 1126-1234
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 428-542
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1649-1758
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-32
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 4 Region: 1472-1591
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-32
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 5 Region: 264-368
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 6 Region: 87-197
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 7 Region: 946-1067
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 779-888
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.97e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 600-721
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 10 Region: 1821-1928
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.09e-25
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 11 Region: 1294-1409
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-23
Family Spermadhesin, CUB domain 0.0058
Further Details:      
 
Domain Number 12 Region: 2292-2360
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 13 Region: 2532-2600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 14 Region: 2648-2716
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.24e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 15 Region: 2349-2416
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.4e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 16 Region: 2827-2895
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 24-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-16
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 18 Region: 2589-2659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.87e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2233-2296
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 20 Region: 2708-2765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000054
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 1763-1831
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000553
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2044-2117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 23 Region: 1590-1653
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000297
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 2465-2525
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 25 Region: 2107-2174
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000175
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 26 Region: 548-608
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 1239-1307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000229
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 28 Region: 891-954
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 29 Region: 2407-2475
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 30 Region: 1066-1129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000324
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 202-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 32 Region: 1416-1479
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 33 Region: 373-441
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 34 Region: 2179-2244
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000653
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 35 Region: 1933-1993
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000764
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 721-783
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000904
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 37 Region: 2886-2944
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000104
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 38 Region: 1990-2045
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000563
Family Spermadhesin, CUB domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022007   Gene: ENSECAG00000024035   Transcript: ENSECAT00000026389
Sequence length 3162
Comment pep:known_by_projection chromosome:EquCab2:2:23026710:23565432:1 gene:ENSECAG00000024035 transcript:ENSECAT00000026389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCNEGYDLQGS
KRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCVWIITAL
NPAKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTGTSVPDLIVSTNHQMWLLF
QTDGSGSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFHHGDTLKFECQPAFELVGQKA
ITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILARPESRIHL
AFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRG
FNITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCILKEGS
VVWNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKITFDRFK
TEVNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQLRYE
TITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFTCDSGYTLSDGEPLECEPNFQWSRALP
SCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLESGHDYL
LITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFSEYDLEP
CEEPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPRCVAEC
GNSVTGTQGTLLSPNFPVNYSNNHECIYSIQTQPGKGIQLKARAFELSEGDVLKVYDGNN
NSARLLGVFSRSEMMGVTLNSTSSSLWLDFITDAQNTSKGFELQFSSFELIKCEDPGTPQ
FGYKVHDGGHFAGSSVSFSCDPGYSLRGSEALLCLSGERRTWDRPLPTCVAECGGTVRGE
VSGQVLSPGYPAPYEHNLNCIWTIEADAGCTIGLHFLVFDTEEVHDVLRIWDGPVESGVL
LKELSGSALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVATATSCNDPGVPQNGSRSG
DSWEAGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCTAPCGGDLTGPSGVILS
PNYPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHIYDGPDSLSPLIGSFYGS
QLPGRIESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDPGSIKNGTRVGSDLKLGS
SITYYCHGGYEVEGSSTLSCILGPDGKPVWNNPRPVCTAPCGGQYVSSDGVVLSPNYPQN
YTSGQICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQHSRLLSSLSGSHTGESLP
LATSNQVLIKFSAKGQAPARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDFSVGAVVR
FECNSGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPEPYLN
SLNCVWKIMVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNST
SNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVVSFQCEPG
YALQGHAHISCMPGTVRRWNYPPPLCIAQCGGVVEEMEGVILSPGFPGNYPSNMDCSWKI
ALPVGFGAHIQFLNFSTEPNHDFIEIRNGPYETSRVMGRFSGSELPGALLSTSHETTVYF
HSDHSQNRPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLIGHPV
LTCQHGTNRNWDHPLPKCEVPCGGNITSSNGTVYSPGFPSPYSSAQDCVWLITVPIGQGI
RLNLSLLQTEPSGDFITVWDGPQQTAPQLGVFTRSSAKKTVHSSSNQVLLKFHHDAAMGA
IFAMAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGSEILTCKLGT
YLQFEGPPPICEGPSGQSPLLKALSGNYSAPLIVTSSSNSVYLRWSSDHAYNRKGFKIRY
SAPYCSLPRAPLHGFLLGQTSTQPGGSIHFGCNAGYRLVGHSMAICTRHPQGYFLWSEAI
PLCQALSCGLPEAPKSGMVFGREYTVGTKAVYSCSEGYHLEAGAEATAECLETGIWSNRN
VPPQCVPVTCPDVSSISVEHGRWRLIFETQYQFQAQLMLICDPGYYYTGQRVIRCQANGK
WSLGNSMPTCQIISCGELPIPPNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANGL
WSGSEVRCLAGHCGTPEPIVNGHINGENYNYRGSVVYQCNAGFRLIGMSVRICQQDHHWS
GKTPFCVPITCGHPGNPINGLTQGNQFNLNDVVKFVCNPGYVAEGAARSQCLASGQWSDT
LPTCRIINCTDPGHQENSIRQVHASGPHRFSYGTTVSYQCNHGFYVLGTPVLSCQGDGTW
DRPRPQCLLVSCGHPGSPPHSQMSGDSYTVGAVVRYSCTGKRTLVGNATRMCGLDGQWTG
SLPHCSGTSMGICGDPGIPAHGIRLGDSFAPGSLMRFSCEAGHALRGSSERTCQANGSWS
GTQPECGVISCGNPGTPSNARVMFSDGLVFSSSIVYECREGYYATGLLSRHCSVNGTWTG
SDPECIVINCGDPGIPANGLRLGNDFRYNKTVTYQCVPGYMMESHRVSVLSCTKDRTWNG
TKPICKAIMCKPPQLIPNGKVVGSDFMWGSSVTYACLEGYQLSLPAVLTCEGNGSWTGEL
PQCFRNLVKDTIKEGRKFKGKHETILTEPWLEARSRLLILGSIRNVAEVNNTWTLGSQPC
TNPTLTMCADPGMPQFGIQNNSQGYQVGSTVLFRCQKGYLLQGSTTRTCLPNLTWSGTPP
DCVPHHCKQPETPTHADVGALDLPSMGYTLIYSCQEGFSLKGGSEHRTCKADGSWTGKPP
VCLVPGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQVVNSKVNATMIDHSGVELHLAGTY
RKEDFHLLLQVYQTTGPVEIFVNKFKDDHWALDGHVSSESSGGTFVYQGSVKGQGFGQFG
FQRLVPPSPSDPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPFNGY
AGHENTNVRATFENPMYDRNIQPTDIMATEAEFTVSTVCTAV
Download sequence
Identical sequences F6QGS3
ENSECAP00000022007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]