SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022090 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022090
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily p53-like transcription factors 7.58e-52
Family T-box 0.00000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022090   Gene: ENSECAG00000024480   Transcript: ENSECAT00000026478
Sequence length 609
Comment pep:known_by_projection chromosome:EquCab2:11:34702701:34710859:-1 gene:ENSECAG00000024480 transcript:ENSECAT00000026478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VREDPKVTLEAKELWDQFHKLGTEMVITKSGRLTLFPFRVRVLGSDRQKRYLPGVTTTGG
DIAQKEKHAHPYLVSSSRANTRVPERMYIHPSPATGEQWMAKPVAFHKLKLTNNISDKHG
FTILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNP
FAKGFRDTGNGRREKRKQLTLPSLRLYEEHCKPERDGAESDASSCDPPPAREPPPSPGAA
PSPLRVHRTRAEEKSCAADSDPEPERLGEERAGPALGRSPALDGGGSPRLPEVERARERR
SPERGKEPADSGGDGPFSLRSLEKERGEGRRKDEGRKEASEGKEPSLAPLEGTDNRVPPL
RARNSCKLCFSRAPTGKNLLGPVSFPVTPAQSEAPIRLFRSDTLGLLLAFVNGGGGSEMS
ARPGSQAGVACPGHQPSTVSSLPSSPYPHTLGSEPLSQRGIPMPTFGGLFPYPYTYMAAA
AAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPSTSLLTTGLAA
EGSKAVGGNSREPSPLPELALRKVGAPSRGALSPSGSAKEAASELQSIQRLVSGLESQRA
LSPGSESPK
Download sequence
Identical sequences F6S6B5
ENSECAP00000022090 9796.ENSECAP00000022090 ENSECAP00000022090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]