SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022212 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022212
Domain Number 1 Region: 213-542
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.85e-71
Family Pancreatic carboxypeptidases 0.00000192
Further Details:      
 
Domain Number 2 Region: 35-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.91e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 542-630
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.85e-20
Family Carboxypeptidase regulatory domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022212   Gene: ENSECAG00000024631   Transcript: ENSECAT00000026609
Sequence length 655
Comment pep:known_by_projection chromosome:EquCab2:1:9022993:9142109:1 gene:ENSECAG00000024631 transcript:ENSECAT00000026609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKNSNRKGVRSKSSEKAASDDHSIPVARDDVREGCPPLGLETLKITDFQLHASTSKRYGL
GAHRGRLNIQAGINENDFYDGAWCAGRNDLHQWIEVDARRLTKFTGVITQGRNSLWLSDW
VTSYKVMVSNDSHTWATVKNGSGDMIFEGNSEKEIPVLNELPVPVVARYIRINPQSWFEN
GSICMRMEILGCPLPDPNNYYHRRNEMTTTDDLDFKHHNYKEMRQLMKVVNEMCPNITRI
YNIGKSHQGLKLYAVEISDHPGEHEVGEPEFHYIAGAHGNEVLGRELLLLLVHFLCQEYL
ARNPRIVFLVEETRIHILPSLNPDGYEKAYEGGSELGGWSLGRWTHDGIDINNNFPDLNT
LLWEAEDRPNSPRKVPNHYIAIPEWFLSENATVAVETRAVIAWMEKIPFVLGGNLQGGEL
VVAYPYDMVRSLWKTQEHTPTPDDHVFRWLAYSYASTHRLMTDARRRVCHTEDFQKEDGT
VNGASWHTVAGSLNDFSYLHTNCFELSIYVGCDKYPHESQLPEEWENNRESLIVFMEQVH
RGIKGLVRDLHGKGIPNAVISVEGVNHDIRTASDGDYWRLLNPGEYAVTAKAEGFTSATK
NCMVGYDMGATRCDFTLSKTNLARIREIMEKFGKQPVSLPARRLKLRGRKRRQRG
Download sequence
Identical sequences F6SS48
ENSECAP00000022212 ENSECAP00000022212 9796.ENSECAP00000022212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]