SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022379 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022379
Domain Number 1 Region: 14-180
Classification Level Classification E-value
Superfamily PR-1-like 1.02e-52
Family PR-1-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022379   Gene: ENSECAG00000024845   Transcript: ENSECAT00000026783
Sequence length 464
Comment pep:known_by_projection chromosome:EquCab2:20:36795611:36803799:1 gene:ENSECAG00000024845 transcript:ENSECAT00000026783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSSHSLLALLLPLLLLLVAITGPAGALSDDEKHVMVKLHNLYRAQVSPPAADMLQMRWD
EELAAFAKAYAQQCIWGHNKERGRRGENLFAITDEAMDVPLAVEQWYQEHDHYNLSAGTC
DPGQMCGHYTQVVWAKTERIGCGSHFCEKLQGVEETNIQLLVCNYEPPGNVKRQRPYQEG
TPCSQCPSGYHCEISLCGESGMGPRRPHPIRVAKPALPSLRSHFGSLAGEVGVARWRGPG
VGGASWWALPEGLAPLGLPRGRRKSPKSGEAEDLPYLVTEAPSSLATEVPSVLATHSQLS
LDEGPATFPKSTHDPTPKSADREASRTRMPSRSPESSLHPKVSLTGTQEPLPYSPEEGEA
EAELPPSTEVSASVIPVQDEPGELQATLDHMGHTSSKSLPNSPNTSATANATGGRTLVLQ
SSLPGAEGPGKPGIKSGLNSGGGRVWVPLLGLLLLPPLVLAGIF
Download sequence
Identical sequences F6QXQ3
ENSECAP00000022379 ENSECAP00000022379 9796.ENSECAP00000022379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]