SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022462 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022462
Domain Number 1 Region: 476-591
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1176-1282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 313-417
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 4 Region: 1690-1810
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 5 Region: 1526-1632
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-30
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 6 Region: 995-1116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-29
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 7 Region: 1861-1980
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2048-2151
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 136-246
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-28
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 10 Region: 828-937
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 11 Region: 655-764
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1343-1458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-21
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 13 Region: 2401-2469
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.08e-19
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 14 Region: 2458-2527
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.27e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 2641-2709
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.47e-18
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 16 Region: 2757-2828
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.26e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 2516-2589
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2817-2886
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 19 Region: 2875-2932
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 20 Region: 2215-2282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 1115-1179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 22 Region: 2938-3005
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000653
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 2698-2762
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000118
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 252-313
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000133
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 2573-2635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 26 Region: 940-1010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 27 Region: 72-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 28 Region: 2343-2405
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000612
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 29 Region: 1289-1352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000931
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 2153-2226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000998
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 597-658
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 32 Region: 422-490
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 33 Region: 1465-1528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 1808-1877
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 35 Region: 1636-1700
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 770-830
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000526
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 37 Region: 1979-2043
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 38 Region: 2996-3055
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 39 Region: 2295-2353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022462
Domain Number - Region: 3-35
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000249
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022462   Gene: ENSECAG00000024680   Transcript: ENSECAT00000026873
Sequence length 3293
Comment pep:known_by_projection chromosome:EquCab2:27:36700469:37399745:1 gene:ENSECAG00000024680 transcript:ENSECAT00000026873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDSSHKNSV
LSQGGVALVSDMCPDPGVPENGRRTGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTET
LAAWSDHRPICRARTCGSNLRGPSGVITSPNYPVQYEDNAHCVWVITTMDPDKVIKLAFE
EFELERGYDTLTVGDAGKVGDTRTVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIASPGF
KAVYQEIEKGGCGDPGVPAYGKRTGSSFLHGDTLTFECQAAFELVGERVITCQQNNQWSG
NKPSCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQF
DFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESIACILQDGNVVWSSTVPRCE
APCGGHLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVR
DGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGRRHGSNFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIH
RKSGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMVFHTFHLESSHDYLLITEDGSFTEP
VARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFQFGVGDSLTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTL
LSPNFPSNYDNNHECIYKIETEAGKGIHLRARNFQLSEGDVLKVYDGKESSSRPLGAFTK
NELMGLILNSTSNHLWLEFNTNGSDTEQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTMVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCVAECGGQIHAATSGRILSPGYP
APYDNNLHCTWIIEADQGKTISLHFIVFDTEMAHDILKVWDGPVDSDILLKEWSGSALPE
DIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGMPQNGTRYGDSREPGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGK
ECDWRIKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESSGN
SLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSGYK
IVDPSSITCVIGADGKPAWNRVLPSCNAPCGGQYSGSEGVVLSPNYPHNYTAGQICLYSI
TVPKEFVLFGQFAYFQTALNDLAELFDGTHPQARLLSSLSGSHSGETLPLATSNQILLRF
SAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSDFSAGSIVRFECNAGYLLQG
STAIRCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVT
EGSGIQIQVLSFATEQNWDSLEIYDGGDMSAPRLGSFSVPALLNSTSNQLYLHFQSDISV
AAAGFHLEYKTVGLAACQEPALPSNSIKTGDRYMVNDVLSFQCEPGYTLQGRSHISCMPG
TVRRWNYPSPLCIATCGGTLSSMGGVILSPGFPGAYPNNLDCTWKVALPIGYGAHIQFLN
FSTEANHDYLEIQNGPYPTSPMIGQFSGTDLPSALLSTTHETLIHFYSDHSQNRQGFKLA
YQAYELQNCPDPPPFQNGYMINADYSVGQSISFECYPGYILIGHPVLTCQHGINRNWNYP
FPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCVWLITVPPGHGIYINFTLLQTEAVND
YIAVWDGPDQNSPQLGVFSGNTALETAYSSNNQVLLKFHSDFSNGGFFVLNFHAFQLKKC
QPPPAVPQAEMLTEDEDFEIGDFVQYRCHPGYTLSGTDTLTCKLSSQLQFQGSLPTCEAQ
CPANEIRTESSGAILSPGYPGNYFNSQTCSWTIKVDPNYNITIFVDTFQSEKQFDSLEVF
DGSSGQSPLLVVLSGNHTEQSNFTSKSHQLYLRWSTDHATSKKGFKIRYTAPYCSLTHTL
KNGGVLNRTTGAVGSKVHYFCKPGYRMIGHSNATCRRNPVGMYQWDSLTPMCQAVSCGIP
ESPGNGSFTGNEFTLDSKVIYECNEGFKLAASQQATAVCQEDGLWSNKGRPPTCKPVTCP
GIEAQLSEHVTWRRVSGSLNEYGAQVVLSCNPGYYLEGRRLVQCQANGTWSVGDERPRCR
VISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRCLAG
HCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLIGTSVRICLQDHKWSGQTPVCVPITC
GHPGNPAHGFTNGTEFNLNDVVNFTCNTGYLLQGASRAQCRSNGQWSSPLPTCRVVNCSD
PGFVENAIRHGQQNFPESFEYGTSVMYHCKKGFYLLGSSALTCMANGLWDRSLPKCLAIS
CGHPGVPANAILTGELFTYGATVHYSCKGSRSLVGNSTRVCQEDSHWSGALPHCTGNNPG
FCGDPGTPPHGSRLGDEFKAKSLLRFSCEMGYQLRGSPERMCLLNGSWSGLQPVCEAVSC
GNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTIISCG
DPGTLANGIQFGTDFTFNKTVSYQCNPGYVMDPVTSPTIRCTKDSTWSHSKPVCKAVMCT
QPPQVQNGKVEGADFHWGASISYSCVDGYQLSHSAILSCEGRGVWKGDTPQCLPVFCGDP
GIPAEGRLSGKSFTYKSEVSFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNACPD
PGTPHFGIQNSSRGYEVGSMVFFKCRKGYHIQGSTTRTCLANLTWSGIQTECIPHACRQP
ETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKMMSVSPT
KSVLNVCEPFTKTPVPSDVFFISSVWKGYYEYLGKRQPATLTVDWFNATSSQVNATFTET
SQVELRLTGVYKKEEAHLLLKAFQIKGPIDIFVSKFENDNWGLDGYVSTFAPANRGFTFQ
GDIHGKDFGKFKLERQDPLSSGQDSSNHSHGTSSGSVAAAILVPFFALILSGFAFYLYKH
RTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences F6PJN2
ENSECAP00000022462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]