SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022464 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022464
Domain Number 1 Region: 476-591
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 1520-1640
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-33
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 3 Region: 1176-1282
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-33
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 4 Region: 313-417
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 5 Region: 1693-1813
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 6 Region: 995-1116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-29
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 7 Region: 1864-1983
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2051-2154
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 136-246
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-28
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 10 Region: 828-937
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 11 Region: 655-764
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 12 Region: 1343-1458
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-21
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 13 Region: 2404-2472
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.08e-19
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 14 Region: 2461-2530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.27e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 15 Region: 2644-2712
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.34e-18
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 16 Region: 2519-2592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 2760-2825
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.48e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 18 Region: 2701-2771
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 19 Region: 2820-2889
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000148
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 20 Region: 2878-2935
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000222
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 21 Region: 2218-2285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000264
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 1115-1179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000347
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 23 Region: 2941-3008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000778
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 24 Region: 252-313
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000133
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 25 Region: 2576-2638
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 26 Region: 940-1010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 27 Region: 2346-2408
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 28 Region: 72-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 29 Region: 1289-1352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000931
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 2156-2229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000998
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 597-658
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 32 Region: 422-490
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 33 Region: 1465-1528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 1811-1880
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 35 Region: 1639-1703
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 770-830
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000526
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 37 Region: 1982-2046
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000103
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 38 Region: 2298-2356
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 39 Region: 2999-3056
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000486
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000022464
Domain Number - Region: 3-35
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000249
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022464   Gene: ENSECAG00000024680   Transcript: ENSECAT00000026875
Sequence length 3289
Comment pep:known_by_projection chromosome:EquCab2:27:36700469:37399745:1 gene:ENSECAG00000024680 transcript:ENSECAT00000026875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLPSPVISSKNWLRLHFTSDSNHRRKGFNAQFQVKKAIELKSRGVKMLPSKDSSHKNSV
LSQGGVALVSDMCPDPGVPENGRRTGSDFSRVGANVQFSCEDNYVLQGSKSITCQRVTET
LAAWSDHRPICRARTCGSNLRGPSGVITSPNYPVQYEDNAHCVWVITTMDPDKVIKLAFE
EFELERGYDTLTVGDAGKVGDTRTVLYVLTGSSVPDLIVSMSNQMWLHLQSDDSIASPGF
KAVYQEIEKGGCGDPGVPAYGKRTGSSFLHGDTLTFECQAAFELVGERVITCQQNNQWSG
NKPSCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQF
DFLAVKDDGISDITVLGTFSGNEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQN
ECHDPGIPINGRRFGDRFLLGSSVSFHCDDGFVKTQGSESIACILQDGNVVWSSTVPRCE
APCGGHLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVR
DGPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSIGFLIHYESVTLESDSCLD
PGIPVNGRRHGSNFGIRSTVTFSCDPGYTLSDDEPLVCERNHQWNHALPSCDALCGGYIH
RKSGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMVFHTFHLESSHDYLLITEDGSFTEP
VARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSR
RIGFQFGVGDSLTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTL
LSPNFPSNYDNNHECIYKIETEAGKGIHLRARNFQLSEGDVLKVYDGKESSSRPLGAFTK
NELMGLILNSTSNHLWLEFNTNGSDTEQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHF
TDTMVLYSCNPGYAMHGSNTLTCLSGDRRVWDKPLPSCVAECGGQIHAATSGRILSPGYP
APYDNNLHCTWIIEADQGKTISLHFIVFDTEMAHDILKVWDGPVDSDILLKEWSGSALPE
DIHSTFNSLTLQFDSDFFISKSGFSIQFSTSIASTCNDPGMPQNGTRYGDSREPGDTVTF
QCDPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGK
ECDWRIKVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESSGN
SLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSGYK
IVDPSSITCVIGADGKPAWNRVLPSCNAPCGGQYSGSEGVVLSPNYPHNYTAGQICLYSI
TVPKEFVLFGQFAYFQTALNDLAELFDGTHPQARLLSSLSGSHSGETLPLATSNQILLRF
SAKSGASARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSDFSAGSIVRFECNAGYLLQG
STAIRCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVT
EGSGIQIQVLSFATEQNWDSLEIYDGGDMSAPRLGSFSGTTVPALLNSTSNQLYLHFQSD
ISVAAAGFHLEYKTVGLAACQEPALPSNSIKTGDRYMVNDVLSFQCEPGYTLQGRSHISC
MPGTVRRWNYPSPLCIATCGGTLSSMGGVILSPGFPGAYPNNLDCTWKVALPIGYGAHIQ
FLNFSTEANHDYLEIQNGPYPTSPMIGQFSGTDLPSALLSTTHETLIHFYSDHSQNRQGF
KLAYQAYELQNCPDPPPFQNGYMINADYSVGQSISFECYPGYILIGHPVLTCQHGINRNW
NYPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCVWLITVPPGHGIYINFTLLQTEA
VNDYIAVWDGPDQNSPQLGVFSGNTALETAYSSNNQVLLKFHSDFSNGGFFVLNFHAFQL
KKCQPPPAVPQAEMLTEDEDFEIGDFVQYRCHPGYTLSGTDTLTCKLSSQLQFQGSLPTC
EAQCPANEIRTESSGAILSPGYPGNYFNSQTCSWTIKVDPNYNITIFVDTFQSEKQFDSL
EVFDGSSGQSPLLVVLSGNHTEQSNFTSKSHQLYLRWSTDHATSKKGFKIRYTAPYCSLT
HTLKNGGVLNRTTGAVGSKVHYFCKPGYRMIGHSNATCRRNPVGMYQWDSLTPMCQAVSC
GIPESPGNGSFTGNEFTLDSKVIYECNEGFKLAASQQATAVCQEDGLWSNKGRPPTCKPV
TCPGIEAQLSEHVTWRRVSGSLNEYGAQVVLSCNPGYYLEGRRLVQCQANGTWSVGDERP
RCRVISCGSLSFPPNGNKIGTLTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGSETRC
LAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLIGTSVRICLQDHKWSGQTPVCVP
ITCGHPGNPAHGFTNGTEFNLNDVVNFTCNTGYLLQGASRAQCRSNGQWSSPLPTCRVVN
CSDPGFVENAIRHGQQNFPESFEYGTSVMYHCKKGFYLLGSSALTCMANGLWDRSLPKCL
AISCGHPGVPANAILTGELFTYGATVHYSCKGSRSLVGNSTRVCQEDSHWSGALPHCTGN
NPGFCGDPGTPPHGSRLGDEFKAKSLLRFSCEMGYQLRGSPERMCLLNGSWSGLQPVCEA
VSCGNPGTPTNGMIVSSDGILFSSSVIYACWEGYKTSGLMTRHCTANGTWTGTAPDCTII
SCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYVMDPVTSPTIRCTKDSTWSHSKPVCKAV
MCTQPPQVQNGKVEGADFHWGASISYSCVDGYQLSHSAILSCEGRGVWKGDTPQCLPVFC
GDPGIPAEGRLSGKSFTYKSEVSFQCKSPFILVGSSRRVCQADGTWSGIQPTCIDPAHNA
CPDPGTPHFGIQNSSRGYEVGSMVFFKCRKGYHIQGSTTRTCLANLTWSGIQTECIPHAC
RQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGV
REVNETVTKTPVPSDVFFISSVWKGYYEYLGKRQPATLTVDWFNATSSQVNATFTETSQV
ELRLTGVYKKEEAHLLLKAFQIKGPIDIFVSKFENDNWGLDGYVSSGLERGGFTFQGDIH
GKDFGKFKLERQDPLSSGQDSSNHSHGTSSGSVAAAILVPFFALILSGFAFYLYKHRTRP
KVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences F6PJL8
ENSECAP00000022464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]