SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022727 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022727
Domain Number 1 Region: 70-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-49
Family Astacin 0.0002
Further Details:      
 
Domain Number 2 Region: 426-598
Classification Level Classification E-value
Superfamily TRAF domain-like 8.67e-40
Family MATH domain 0.00078
Further Details:      
 
Domain Number 3 Region: 264-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-29
Family MAM domain 0.0035
Further Details:      
 
Domain Number 4 Region: 670-712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000111
Family EGF-type module 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022727   Gene: ENSECAG00000025147   Transcript: ENSECAT00000027162
Sequence length 744
Comment pep:known_by_projection chromosome:EquCab2:20:45355844:45388885:1 gene:ENSECAG00000025147 transcript:ENSECAT00000027162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWSRSICLLSFILLFAHIAAVSIRRPSEENDFGEQKDISEINLAAGLDLFQGDILLRNS
RNALREPNARWKFPIPYILADNLDLNAKGAILYAFEMFRLKSCVDFKPYEGESSYIIFQQ
FSGCWSEVGDQHVGQNISIGQGCGYKAIIEHEILHALGFYHEQSRTDRDDYVNIWWDEII
SGYQHNFNTYDDNFITDLNTPYDYESVMHYGPFSFNKDASVPTITAKIPEFDSIIGQRLD
FSAVDLERLNRMYNCTTTHTLLDHCAFEKTNICGMIQGTRDDVDWLHEDSSQPEQVDHTL
VGQCTGAGYFMHLNTSSGSTEEAALLESRILYPKRKEQCLQFFYRMTGSPSDRLVVWVRR
DDGTGNVRKLVKVKTFQGDSDQNWKIAHVTLREEKKFRYLFQGTKGDPQNSNGGIYLDDI
TLTETPCPTGVWTVRNFSQVLQNTVKGDRLLSPRFYNSEGYGFGLTLYPHGTNSSSSGYI
RLAFHLCSGENDAILEWPVENRQVIITVLDQEADVRNRMSSSMVFTTSKSQTSSAINGSV
IWDRPSVVGSYYSDCDCFRSIDLGWNSFMSHQMLNRRSFLKNDDLILLVDFEDITHLNQT
EVQAKDSRMIPQGLILQGQEQQASEEGSGKALLEKALPDSLDQGQSGRQKRSVENTGSLE
DHNWPQYFGDPCDPNPCQNEGICVNVKGTASCRCTSGHAFFYTGEHCQAMQMQGSILGLM
IGGTAGVVFLTLTIISIHSGRRRQ
Download sequence
Identical sequences F6SNI3
ENSECAP00000022727 9796.ENSECAP00000022727 ENSECAP00000022727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]