SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000022787 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000022787
Domain Number 1 Region: 238-365
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-32
Family Second domain of FERM 0.0019
Further Details:      
 
Domain Number 2 Region: 369-470
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-26
Family Third domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 16-103
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000306
Family PDZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 149-200
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000413
Family Ras-binding domain, RBD 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000022787   Gene: ENSECAG00000024553   Transcript: ENSECAT00000029038
Sequence length 965
Comment pep:known_by_projection chromosome:EquCab2:X:84992445:85050175:1 gene:ENSECAG00000024553 transcript:ENSECAT00000029038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHVMQEESANDMECEQLPAETLRQVTIHRDPIYGFGFVAGSERPVVVRSVRPGGPSEDKL
LAGDQIVAINEEDVSEAPRERFIELIRSAKEFPMLTVLHTHQSPKSAFISAAKKAKLRSN
PVKVRFSEQVAVGETDAKMMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQ
DRLSLRYIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYQGMKCLFRISFFPKDP
VELLRRDPAAFEYLYIQSRNDVIRERFGMDPKPEMLLGLAALHIYITVSATRPSQKISLK
NVEKEWGLEPFLPPSLLQGIKEKNLRKSLSQQLKAHQTHPSSGTKGSAIQAKLQYLRILN
ELPTFTGVLFNTVGLDEKQSATTLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFRE
NQGVARVETSIMDAKPLVLLMEWPEATNFACLIAGYCRLLLDSRKMVFSRPASQPLPPPM
IKADYMHSAHRPVTGGHLGKKESSYVGSVGTSPRKSSRCTPPPANSELVSFCYLHMREQR
KEQESRTDVNENLIFFEETRPRTKSDPTSKSSGQGYTVVPDDFDAASLDHEPCASRARSY
TLDNSLGAEALNFYCDSCKAKLQEQLGPRKAGRPGSSRDNMVDLMSLPPPGSEEEEEEED
ESTSLLPAIAAPPPGFRDNSSDEDDPKRRAVQSQEQGRHLRGLLYDEIPVTLIDSVQTRT
VRDHAQELDDALVSTLQALEALAASEDGPHPPPPQTAGLIVLATITPESSLDSGHETNSS
ELTDMSEMMSAMKQHQNTTYFLAQHLNKDSLLARKDLPFRIQSCAAQAVLTAPYSLGRPD
PNPSLQPAVTGQSPGPPGARRKLPQSEAQSQRERTYALAVHPALSPQLSEQKNLSLLSPV
PEDKGPGHPRAGLEMSLRAATPSLSEEQVCELRENLPKEVRLSPKLILDPKGSVTPAIIS
AALHR
Download sequence
Identical sequences F6S845
ENSECAP00000022787 ENSECAP00000022787 9796.ENSECAP00000022787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]