SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000023058 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000023058
Domain Number 1 Region: 7-97
Classification Level Classification E-value
Superfamily PKD domain 0.00000000641
Family PKD domain 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000023058
Domain Number - Region: 108-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00662
Family LDL receptor-like module 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000023058   Gene: ENSECAG00000026818   Transcript: ENSECAT00000028860
Sequence length 296
Comment pep:known_by_projection chromosome:EquCab2:31:16978287:17006713:1 gene:ENSECAG00000026818 transcript:ENSECAT00000028860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLTEKDEPPLSKAGQDVVLHLPADGVILDGRESTDDHAIVQYEWTLLHGDPSVEMKVPQA
GTLELSHLQEGAYTFQLTVTDTAGQRSSDNVSVTVLPRAFSTGGYLSVCSRYHFFWDDGC
FTDTTLAFEGVEQCPDGSDEAFSTLSLDQKMGTRTATAQPRTTGPSKDARGGSLLEKPQK
VTAPNQPPASSNTEKRNHSAFWGPESPTDPGMPDSSSSGKNRKKENYIFESRSDRGGGEH
PAPEAGAVLPLALGLAITASLLLMVACRLRLVKQKLKKARPITSEESDYLINGMYL
Download sequence
Identical sequences F6ZIE6
ENSECAP00000023058 9796.ENSECAP00000023058 ENSECAP00000023058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]