SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000023063 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000023063
Domain Number 1 Region: 103-305
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.37e-75
Family T-box 0.00000000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000023063   Gene: ENSECAG00000012861   Transcript: ENSECAT00000029064
Sequence length 403
Comment pep:known_by_projection chromosome:EquCab2:8:18209736:18218248:1 gene:ENSECAG00000012861 transcript:ENSECAT00000029064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFLPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPRDHATWQGNYSFGTQT
ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDDRHRKENGTSDESSSEQAAFNCFAQSSSPAVSTV
GTSNLKDLCPSEGESDAEAESKEARLPEPCERGRISTTTSEEP
Download sequence
Identical sequences F6ZHS6
ENSECAP00000023063 ENSECAP00000023063 9796.ENSECAP00000023063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]