SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000000016 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000000016
Domain Number 1 Region: 18-487
Classification Level Classification E-value
Superfamily Sema domain 6.28e-130
Family Sema domain 0.0000217
Further Details:      
 
Domain Number 2 Region: 1331-1457,1652-1841
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-53
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 933-1021
Classification Level Classification E-value
Superfamily E set domains 4.71e-16
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 4 Region: 1020-1124
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000011
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.077
Further Details:      
 
Domain Number 5 Region: 836-935
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000194
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 490-542
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000837
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1121-1211
Classification Level Classification E-value
Superfamily E set domains 0.000000434
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 8 Region: 789-821
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000445
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000000016   Gene: ENSECAG00000000022   Transcript: ENSECAT00000000016
Sequence length 1871
Comment pep:known_by_projection chromosome:EquCab2:Un0001:1139222:1185050:1 gene:ENSECAG00000000022 transcript:ENSECAT00000000016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVAGVPGAAGGLRPTFRTFAASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAHV
TGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLDD
LFKLGEPHHRKEHYLSSVREAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSSRR
LMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDT
QLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPIGCEQAGVEYRLVQDAYLSRPGRTLA
RQLGLAEDEDVLFTVFAQGQKNRVKPPKESVLCLFTLRAVKEKIKERIQSCYRGEGKLSL
PWLLNKELGCINSPLQIDDDFCGQDFNQPLGGTITIEGRPLFVDKDDGLTAVAAYDYQGR
TVVFAGTRSGRIRKILVDLANPGGRPALAYESVVAQEGSPILRDLVLSPDRQYLYAMTER
QVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRQDACERAAEPRRFAADLLQCVQ
LTVQPRNVSVTMSQVPLVLQAWNVPDLSAGVNCSFEDFTESESILEDGRVHCRSPSAREV
APITRGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHV
CTHNAADCAFLEGRVNMSEDCPQILPSTQIYVPVGVVKPISLAARNLPQPQSGQRGYECL
FHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDISDLPVNLSVVWNGNFVIDNPQNIQAH
LYKCPALRESCGLCLKADPRFECGWCVAERRCSLRPHCPADSPAAWMHARHGSSRCTDPK
ILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVRVGKVLCSPVESEYISAEQIVCEIG
DASTVRAHDALVEVCVRDCTPQYRALSPKRFTFVTPTFYRVSPARGPLSGGTWIGIEGSH
LNAGSDVAVSVGGRPCSFSWRNSREIRCLTPPGQSPGSAPIVVNINRAQLTNPEVKYNYT
EDPTILKIDPEWSISSGGTLLTVTGTNLATVREPRIRAKYGGVERENSCLVYNDTTMVCR
APSVDNPARSPPELGERPDELGFIMDDVRSLLVLNASSFLYYPDPVLEPLSPTGLLELKP
SSPLILKGRNLLPPAPGNSRLNYTVLIGSTPCALTVSETQLLCESPNLTGQHKVTVRAGG
FEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQM
DNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEM
EVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYAT
GVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLY
CAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPVKGLNC
DTVTQVKEKLLDAVYKGVPYSQRPKAADMDLEWRQGRMARIILQDEDVTTKIDNDWKRLN
TLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITP
DLESGTKLWHLVKNHDHLDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTA
HRGSALPLAIKYMFDFLDEQADQHQIHDADVRHTWKSNCLPLRFWVNVIKNPQFVFDIHK
SSITDACLSVVAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYADIAKMPA
ISDQDMSAYLAEQSRLHLSQFNSMSALHEIYSYITKYKDEILMALEKDEQARRQRLRSKL
EQVVDTMALSS
Download sequence
Identical sequences H9GZM5
ENSECAP00000000016 9796.ENSECAP00000000016 ENSECAP00000000016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]