SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003260 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003260
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-67
Family RUNT domain 0.000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003260   Gene: ENSECAG00000003462   Transcript: ENSECAT00000004699
Sequence length 453
Comment pep:known_by_projection chromosome:EquCab2:26:31257118:31347533:-1 gene:ENSECAG00000003462 transcript:ENSECAT00000004699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALIGKPRSVDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYQRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSITSPSVHPATPISPGRASGMTTLSAELSSRLSKTPLF
TGKGDFFFFKGMSNMCTPKSHIDRLHTLSENSWARVGLLSSTPSGGETFPTKIPEPPNPQ
ISYSLKAPCEYQGSPPLHLFVKASSGSYFFSMVGGRSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPAARLEEAVWRPY
Download sequence
Identical sequences F6QMT3
9796.ENSECAP00000003260 ENSECAP00000003260 ENSECAP00000003260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]