SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003304 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000003304
Domain Number - Region: 46-140
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.034
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003304   Gene: ENSECAG00000004884   Transcript: ENSECAT00000004757
Sequence length 303
Comment pep:novel chromosome:EquCab2:1:177439667:177440575:-1 gene:ENSECAG00000004884 transcript:ENSECAT00000004757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKYIKSPEQKENNKDTENNPKENEIYNLNDDDFKTAIIKILNELRENSDRQLNEFRSYV
TKEFDTIKKNQTEILEIKNTIEEIKKNLDALNSRADNMEERISNLEDGNIELLQAEEERE
ARLKRNEETLQELSDTIRRCNVRIIGIPEGEEKEKGAESLFKEIMAENFPNLVREMDLQV
TEANRSPNFINARRPTPRHIVVKLAKVNDKEKILRTARQKKLTYKGTPIRLSADFSAETL
QARREWNDIFKNLKDKNLQPRILYPAKISFKYDGEIKTFPDKQKLREFIATKPPLQEILR
KTL
Download sequence
Identical sequences F6PI95
9796.ENSECAP00000003304 ENSECAP00000003304 ENSECAP00000003304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]