SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000003819 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000003819
Domain Number 1 Region: 91-172
Classification Level Classification E-value
Superfamily HMG-box 8.64e-21
Family HMG-box 0.0000306
Further Details:      
 
Domain Number 2 Region: 213-309
Classification Level Classification E-value
Superfamily HMG-box 5.76e-20
Family HMG-box 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000003819   Gene: ENSECAG00000005505   Transcript: ENSECAT00000005427
Sequence length 388
Comment pep:novel chromosome:EquCab2:7:56560803:56561966:-1 gene:ENSECAG00000005505 transcript:ENSECAT00000005427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRESQDHWSKEDIVKLLERMENNLPSNERHTFKTTQSQMDWGKVAFKDFSGEMCKLKW
VEISYTLRKFRTLKELVLEAKEHAKKLSKSKKHRKHPDFPKKPLTAYLRFFKERRPQCSQ
MHPTLSNQQLTKLLSEEYRELPEQVKLKYIQDFQKEKQEFEEKVARFREAHPALVQNSKK
SNVPKRSPTKAPKKMQGSEKEVKSSPQTSFSQKMKFHGEPKKPPMHEYQKFHEDLWSSRE
LQDLPLRERMVEIGRRWQRIPQSQKEHCKKQAEELQKQYKVDLDRWLQSLSPEEYAAYRE
ATYTKRKNLGMRGGSNPKIRRTDLPSPSARSPQEGLGEEQELQASETESSESVGVTSLSS
LGSEDNKEDGEEEEGRNSSDSSSEEEDG
Download sequence
Identical sequences F6ST96
ENSECAP00000003819 9796.ENSECAP00000003819 ENSECAP00000003819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]