SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000004071 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000004071
Domain Number 1 Region: 33-152
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.92e-45
Family Frizzled cysteine-rich domain 0.000000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000004071   Gene: ENSECAG00000005857   Transcript: ENSECAT00000005775
Sequence length 170
Comment pep:known_by_projection chromosome:EquCab2:29:2704994:2705503:1 gene:ENSECAG00000005857 transcript:ENSECAT00000005775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPP
Download sequence
Identical sequences F7AS02
ENSECAP00000004071 9796.ENSECAP00000004071 ENSECAP00000004071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]