SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005046 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005046
Domain Number 1 Region: 694-982
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-78
Family Protein kinases, catalytic subunit 0.000000000326
Further Details:      
 
Domain Number 2 Region: 421-600
Classification Level Classification E-value
Superfamily Fibronectin type III 1.39e-27
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 3 Region: 314-439
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000113
Family Fibronectin type III 0.0059
Further Details:      
 
Domain Number 4 Region: 217-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000109
Family I set domains 0.038
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005046
Domain Number - Region: 2-77
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000263
Family I set domains 0.05
Further Details:      
 
Domain Number - Region: 90-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00231
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 78-209
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0173
Family Growth factor receptor domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005046   Gene: ENSECAG00000006177   Transcript: ENSECAT00000006987
Sequence length 1001
Comment pep:known_by_projection chromosome:EquCab2:2:14913137:14928215:-1 gene:ENSECAG00000006177 transcript:ENSECAT00000006987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGDTAVLSARVRKEKQMDVIWKSNGSYFSTLDWHEAQDGRFLLRFPDVQPPSSGIYSATY
LEASPLGSAFFRLIVRGCEAGRWGPGCTKECPGCLHGGVCHDQDGECVCPPGFTGTRCEQ
ACREGRFGQSCQEQCPGTSGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRL
RCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILDVASELEFNLETMPRINCAAAGN
PFPVRGSMELRKPDGTVLQSTKAIVEPDRTTAEFEVPRLTLGDSGLWECRVSTSGGQDSR
RFRVNVKVPPVARTAPRLLAKQSRQLVVSPLVSFSGDGPIASVRLHYRPQDSTMDWSAIV
VDPSENVTLMNLRPKTGYSVRVQLSRPGDGGEGAWGPPTLMTTDCPEPLLQPWLEGWHAE
GPDRLRVSWSLPSVPGPLVGDGFLLRLWDGARGQERRENVSSPQARTALLTGLTPGTHYQ
LDVRLYHCTVLGPASPPARVLLPPSGPPAPRHLQAQALSDSEIQLMWQRPEALAGPISKY
IVEVQVAGGSGDPLWMDVDRPEETSTIVRGLNASTRYLFRVRASVQGPGDWSNMVEESTL
GNGLQSGDPVQEIRAAEEGLDKQLILATVGSVSATCLTILAALCTLVCIRRSCLHRRRTF
TYQSGSGEETILQFSSGTLTLTRRPKPQPEPLNYPVLEWEDITFEDLIGEGNFGQVIRAM
IKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACENRGYLYIAI
EYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIH
RDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVW
SFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYER
PPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Download sequence
Identical sequences F7E396
ENSECAP00000005046 9796.ENSECAP00000005046 ENSECAP00000005046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]