SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000005931 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000005931
Domain Number 1 Region: 332-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000109
Family Laminin-type module 0.042
Further Details:      
 
Domain Number 2 Region: 817-865
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000725
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 3 Region: 970-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family Laminin-type module 0.0028
Further Details:      
 
Domain Number 4 Region: 863-913
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 5 Region: 265-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000155
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 6 Region: 923-972
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 7 Region: 455-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1080-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000474
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 9 Region: 506-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000698
Family Laminin-type module 0.0095
Further Details:      
 
Domain Number 10 Region: 414-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 769-819
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0043
Further Details:      
 
Domain Number 12 Region: 1128-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 13 Region: 1034-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.005
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000005931
Domain Number - Region: 100-159
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00623
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000005931   Gene: ENSECAG00000007624   Transcript: ENSECAT00000007989
Sequence length 1252
Comment pep:known_by_projection chromosome:EquCab2:4:7968455:8035154:-1 gene:ENSECAG00000007624 transcript:ENSECAT00000007989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFQLTFFLHLGLLSYAKAQDECHRGACHPTTGNLLVGRGAQLTASSTCGLDGAQKYCIL
SYLEGEQKCFICDSRFPYDPYAQPNSHTIENVITSFEPDREKKWWQSENGLDHVSIRLDL
EALFQFSHLILTFKTFRPAAMLVERSTDYGHTWKVLKYFSKDCAASFPNVTSGQAQGVGD
LVCDSKYSDIEPSTGGEVVLKVLDPSFEIEDPYSPHIQDLVTLTNLRINFTKLHTLGDTL
LGRRENDSLDKYYYALYEMVVRGSCFCNGHASECGPMQTVRGDVFSPPGMVHGRCVCQHN
TDGPNCERCKDFFQDAPWRPAAGLQDSTCRACSCNGHSDRCHFNSTVYLASGGLSGGVCE
DCQHNTEGQHCHRCRPLFYRDPLKAISDPYACIPCECDPDGTISGGICVSHSDPAVGSVA
GQCLCKDNVQGAKCDQCQPNHYGLSAADPLGCQPCDCHPHGSLPLSPCDVDTGQCLCQPS
ATGPRCDECAVGYWGLENHLHGCSPCDCDIGGAYSNVCSPKDGQCECRPHITGRSCTEPA
PGYFFAPLNFYLYEAEEAMPLQGLAPLGSATFGQVPADHGVFPEPVPGSPVTWTGPGFAR
VLPGAGLRFTVNNIPSAMDFAVAIRYETQSADDWAVQIMVNPPRGSKHCTRKTPWPKPQS
FALPAASRIVLLPTPICLEPDVQYSIDVYFSQPLEGRSHAHSHILVDSLGLIPQINSLEN
FCSEQDLDEYQLHNCVEIASEARPRVLPSACERLIVSVSARLHEGAVACKCHPQGSVGPS
CSRLGGQCQCKPHVAGRCCDRCSAGSYGLGHHGCHSCHCHPEGSKSIVCDQITGQCPCQG
EVAGRRCDRCLAGYFGFPNCRPCLCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQSCRPCPCPDVPSSNQYFAHSCYQNPWGSDVICDCLQGYTGKQCEECSAGFYGNP
RISGAPCQPCACNNNIDLSDPDSCSRVTGECLRCLHNTHGPNCQLCKPGHFGSAINQTCR
RCSCHPSGVNPAECRPDQGACLCDPDTGTCPCLPNVTGQACDHCADGYWNMIPGRGCQPC
DCDPQTSHSRHYDHVTGQCLCKLGYDGKRCSECKENYYGDPQGRCIPCDCNQEGTQKPVC
DQATGMCRCQEGVSGPRCDRCARGHNQEFPACLPCHSCFDQWDHTISSLSKAVQGLIRLA
ATMDDKRETLPACEADFKDLTENMSEIERILKHPVFSSGEFLKVKDYHDSVR
Download sequence
Identical sequences F7C2R4
ENSECAP00000005931 9796.ENSECAP00000005931 ENSECAP00000005931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]