SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006206 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006206
Domain Number 1 Region: 218-362
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-37
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-31
Family Second domain of FERM 0.0000778
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-26
Family First domain of FERM 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006206   Gene: ENSECAG00000007878   Transcript: ENSECAT00000008303
Sequence length 556
Comment pep:known_by_projection chromosome:EquCab2:23:8770830:9051128:1 gene:ENSECAG00000007878 transcript:ENSECAT00000008303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASCHCVPRGRRTMKMIHFRSSSIKSLSQEMKCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIFKQMKSHPPYTMCFRVKFYPHEPLKIK
EELTRYLLFLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYDPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHTLETYGVDPHPCKDSTGTTTFLGFT
AAGFVVFQGNKRIHLVKWPDVCKLKFEGKTFYVIGTQKEKKAMLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQRDPPEVHRTNI
TQSRSSHSLNKQLIINMEPLQPLLPCPCEQEEELPLGEGVPLPKEDNISAPLISSSPVKE
AREYENPPREEEDKIREEPLTISELAYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDT
DSFEDLEADENAFLMAEEEELKEAHQALSWSYDILSGHIRVNPLVKIFSRLLVVGLGLLL
FVFPLLLLLLESAALQ
Download sequence
Identical sequences F6TLA7
ENSECAP00000006206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]