SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006225 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006225
Domain Number 1 Region: 1-740
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.65e-268
Family Motor proteins 0.000000000132
Further Details:      
 
Domain Number 2 Region: 1153-1250
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-28
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 1333-1452
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-22
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1736-1805,1848-1892
Classification Level Classification E-value
Superfamily Second domain of FERM 3.95e-18
Family Second domain of FERM 0.008
Further Details:      
 
Domain Number 5 Region: 1270-1326
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000194
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1116-1154
Classification Level Classification E-value
Superfamily PH domain-like 0.000000173
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006225
Domain Number - Region: 1643-1729
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0176
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number - Region: 764-874,1156-1181
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0251
Family FCH domain 0.081
Further Details:      
 
Domain Number - Region: 1896-1982
Classification Level Classification E-value
Superfamily PH domain-like 0.0479
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006225   Gene: ENSECAG00000007941   Transcript: ENSECAT00000008326
Sequence length 2000
Comment pep:known_by_projection chromosome:EquCab2:21:43677424:43840728:1 gene:ENSECAG00000007941 transcript:ENSECAT00000008326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPMNEEGVDDMATLTEFHGGSIMHNLHQRYKRNQIYTYIGSIIASVNPYKTIAGLYERA
TMERYSKCHLGELPPHVFAIANECYRCLWKRHDNQCVLISGESGAGKTESTKLILKFLSV
ISQQSLELSSKEKTSCVEQAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQ
GGKIVDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEEREEFYLSVPENYHYLNQSGCVE
DKTISDQESLREVIMAMEVMQFSKEEVREVLRLLAGILHLGNIEFITAGGAQVSFKPALG
RSAELLGLDPTQLTDALTQRSMFLRGEEILTPLNVQQAADSRDSLAMALYARCFEWVIKK
INSRIKGKDDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNRHIFSLEQLEYSR
EGLVWEDIDWVDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVK
PRVAVNNFGVKHYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNN
QDTLKCGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNTQKMPDQFDQAVVLNQ
LRYSGMLETVRIRKAGYAVRRPFQDFYKRYKVLMRNVALPEDIRGKCTALLQLYDATNSE
WQLGKTKVFLRESLEQKLEKRREEEVTRAAMVIRAHVLGYLARKQYRKVLYCVVIIQKNY
RAFLLRRRFLHLKKAAIVFQKQLRGRIARRVYRQLLAEKREAEEKRRREEEEEKRRQEEE
ERERERARREAELRAQQEEAARKQQELEALQKSQREAELNRELEKQKENKQVEEILRLEK
EIEDLQRMKERQELSLTEASLQKLQQLRDEELKRLEDEACRAAQEFLESLNFDEIDECVR
NIERSLSVASEFSGELGELAESACGEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSE
HGHSDQRTSGIRTSDESSEEDPYMNDTVVPTSPSADSTVLLAPSEHGSSSGEPTYCMPQN
TAGLPSPDGDFDYDQDDYEDGAITSGSSVTFSNSCSSQWSPDYRCSVGTYNSSGAYRFSS
EGAQSSFEDSEEDFDSRFDTDDELSCRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCV
LKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEKLK
GTVEVRTAKEIIDNTSKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIRE
MHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITL
LQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNALK
LGTLVLNSLCSVVPPDEKIFKETGYWNITVYGRKHCYRLYTKLLNEATRWSSAIQNVTDT
KAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRHTHHPLHSPLLPLPYGDINLNLLK
DKGYTTLQDEAIKIFNSLQQLESVSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVP
HPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESLKK
TKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDS
RNMFALFEYNGHVDKAIESRTIVADVLAKFEKLAATSEAGDLPWKFYFKLYCFLDTDNVP
KDSVEFAFMFEQAHEAVIHGHYPAPEENLQVLAALRLQYLQGDYTLHATVPPLEEVYSLQ
RLKTRISQSTKSFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEEVS
SARAGIIDKWKKLQGMSQEQAMAKYMAVIKEWPGYGSTLFDVECKEGGFPQELWLGVSAD
AVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYIS
MIVKKRYSASRSVSSQGSSR
Download sequence
Identical sequences F6TKJ8
ENSECAP00000006225 ENSECAP00000006225 9796.ENSECAP00000006225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]