SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006744 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006744
Domain Number 1 Region: 254-467
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-46
Family Protein kinases, catalytic subunit 0.00000053
Further Details:      
 
Domain Number 2 Region: 119-248
Classification Level Classification E-value
Superfamily SH2 domain 1.54e-39
Family SH2 domain 0.0000021
Further Details:      
 
Domain Number 3 Region: 59-150
Classification Level Classification E-value
Superfamily SH3-domain 9.87e-23
Family SH3-domain 0.0000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006744   Gene: ENSECAG00000008319   Transcript: ENSECAT00000008942
Sequence length 467
Comment pep:known_by_projection chromosome:EquCab2:10:60996166:61079391:-1 gene:ENSECAG00000008319 transcript:ENSECAT00000008942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGCAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLC
CRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMAFWFGNTQVAKT
TYKFMKRIPDDHHVQNQPLHKTKYSLLLGIFIFQSKLKRFYVLFIGSLLDFLKDGEGRAL
KLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTA
RQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPG
Download sequence
Identical sequences F6T9G2
9796.ENSECAP00000006744 ENSECAP00000006744 ENSECAP00000006744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]