SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006762 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006762
Domain Number 1 Region: 28-123
Classification Level Classification E-value
Superfamily Snake toxin-like 4.2e-25
Family Extracellular domain of cell surface receptors 0.027
Further Details:      
 
Domain Number 2 Region: 136-225
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000236
Family Extracellular domain of cell surface receptors 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006762   Gene: ENSECAG00000008763   Transcript: ENSECAT00000008961
Sequence length 351
Comment pep:known_by_projection chromosome:EquCab2:10:14484913:14488626:-1 gene:ENSECAG00000008763 transcript:ENSECAT00000008961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAEKAGARAVIWTLGWLLLPLLLQEGAQALECYSCVQKADDGCSPHKMKTVKCPAGVD
VCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNL
TSRALNPAGNESAYEPNGAECYSCVGLSRQACQGKAPPVVSCYNASDRVYKGCFDGNVTL
TAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPEFPPLV
LLPAPKTTTRAPTTSVTTSTPAPTTTTTTTTTTSTAKPTSARASQTPPREGEPETSEEEE
ESSLPGGAAGHQDRSNKQQYPTKGGAHDNGSATPSAGLAALLLAVAAGTLL
Download sequence
Identical sequences F6T8J7
XP_001501849.1.31192 9796.ENSECAP00000006762 ENSECAP00000006762 ENSECAP00000006762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]