SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006832 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006832
Domain Number 1 Region: 711-980
Classification Level Classification E-value
Superfamily RNI-like 5.99e-50
Family 28-residue LRR 0.0000684
Further Details:      
 
Domain Number 2 Region: 1369-1452
Classification Level Classification E-value
Superfamily DEATH domain 1.46e-16
Family Caspase recruitment domain, CARD 0.022
Further Details:      
 
Domain Number 3 Region: 323-494
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000016
Family Gluconate kinase 0.093
Further Details:      
 
Domain Number 4 Region: 2-88
Classification Level Classification E-value
Superfamily DEATH domain 0.000000647
Family Pyrin domain, PYD 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006832   Gene: ENSECAG00000008523   Transcript: ENSECAT00000009041
Sequence length 1454
Comment pep:known_by_projection chromosome:EquCab2:11:49066813:49116928:1 gene:ENSECAG00000008523 transcript:ENSECAT00000009041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGAELQWPWYLESREKKEPKEFQLRLPDAHSRHSPGETVAQVEASGPEVASRLVALYG
QRQAWDLALLTQRRMDLSRVSIQAHREAASIPISSLHASLGKPNLEFSSAPTSTMVLGHW
VPEAPGLLQDSQRKNLRHLPGTSGHTWKENPPSFPFQDFPYSPVCESPSQESPNAPTSTA
VLGGWEFPPQSMLACRKQEPPRTAWPLAETSGKHSTVVEGRDRRGHLTGVPLMAAEPGSE
PQAHTEHPGLWERYQKQWRETPCPTQSRQNEDLHQKFVQLLLLHTSDPGSHESLVRRCCP
HGVVEEEGHLIEIGDLFGPGLGTQRGPHTVVLHGVTGIGKSTLARQVRGAWEEGRLYRDR
FQHVFYFNCTELAQSKPVSLAKLMGEDCAAPAPPIRSQQEKMLFILDGLDEPELVLEEQR
PLCEDWSLRQPVPRVLHSLLRKVLLPEASLLVTARTPAPQKFILSLEHPHWVEVLGFSES
SRKEYFYRYFTEESQAVQAFSLVESNPALLTLCLVPFVSWMVCTCLKQQMERGEELSLTS
QTTTALCLHYLSQALPAQPLRTQLRCLCSLAAEGVGQGETLFSLNDLRKHRLDGACISTL
LKMGLLQKHPTSQRYSFIHPFFQGFFAAMSYALGDKEKSDHLNSTRRIKKLLEKCERHDP
FGTPTTPFLFGLLSEQGVRKMEHIFRCKLSQERKGDLLQKVRRGHPSLPPYSLQVLRCLY
EIQDEDFLTQAMAHFQRTRMYVQTDMELLVFTFCVKFCHHVERLQLNESGPHRQAWRPSS
VVLLSRAPVTDACWKVLFSVLQVTGSLKELDLSGNFLSLSAVQSLCEALRHPRCHLQTLR
LASCGLTAEGCKDLASGLSTSQTLTELELSCNVLEDAGVKHLCQGLRQPSCVLQRLLLVS
CGLTSGFCQDLASVLSAGSRLTELDLQQNKLGDLGVKLLCEGLRRPTCQLMLLWLDQTQL
NEEVTEMLRALEKNAQLLILSRWKPSVTTPNEGRDGGEMSENRCSLKRQRAESARAQSPK
AHSGLLSLELTTALPVPESSSPQVVQVQPLFLPFPASPGDPHVEPLETKDDFWGPMGPVA
TEVVDKERSLYRVHLPMAGSYRWPNTGLHFVVRGPVTIEIEFCAWGQFLDRTVPQHSWMV
VGPLFDIKAEPGAVAAVYLPHFVVLQGAHVDISLFQVAHFKEEGMLLEKPARVEPCYAVL
ENPSFSPVGVLLRMIHAALPFIPVTSTVLLYYHFQPEEVTFHLYLIPNDCTIRKAIDDEE
KKFQFVRIHKPPPLTPLYVGSRYTVSGSKKLEIIPKELELCYRSPGESQLFSEFYIDHFG
TGIKLQMRDKKDGTVVWEALVKRGKVETKAVVKPSCLLAVSPSHGLAPASLHFVDRYREQ
LVARVTSVDPVLDKLHGLVLSEEQYEKVRAEATTPSQMRKLFSFSKSWDWACKDKFYQAL
KETHPHLIVELWEK
Download sequence
Identical sequences F6RNB9
ENSECAP00000006832 9796.ENSECAP00000006832 ENSECAP00000006832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]