SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000006979 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000006979
Domain Number 1 Region: 179-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000229
Family EGF-type module 0.016
Further Details:      
 
Domain Number 2 Region: 124-271
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000659
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000006979
Domain Number - Region: 64-122
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 0.0706
Family Creatinase/aminopeptidase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000006979   Gene: ENSECAG00000009029   Transcript: ENSECAT00000009204
Sequence length 546
Comment pep:known_by_projection chromosome:EquCab2:1:60741912:60763330:1 gene:ENSECAG00000009029 transcript:ENSECAT00000009204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQFLLLTCLFITITPVSPRALDPCSAYISLNEPWRNTDHQFDESQGPPLCDNHVDGEWY
RFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEGDGIVQRQACASFNGNCCLWNTTVE
VKACPGGYYVYRLTRPSVCFHVYCGHFYDICDEDCHGSCLDPSDCTCSPGTVLGPDRQTC
FDENECEQNNGGCSEICVNLKNSYRCECGAGRVLKSDGKTCEDIEGCHNNNGGCSHSCLM
SEKAYQCECPRGLVLSEDNHTCQVPVLCKSNTIEVSIPRDLVGGLELFLTNTSCRGVSNG
THVNILFSLKTCGTVVDVVNDKIVASNLVTGLPKQTPGSSGDIIIRTSKLLIPVTCEFPR
LYTISEGYVPNLRNTPLEIMSRSHGIFPFTLEIFKDNEFEEPYREALPTLKLRDSLYFGI
EPLVHVNGLESLVESCFATPTSKIDEILKYYLIRDGCVSDDSVKQYTSRDHLAKHFQVPV
FKFVGKDHKEVFLHCRVLVCGMLDERSRCAQGCHRRMRREAVEGEDTAGPQSQMLTGGPI
SIDWED
Download sequence
Identical sequences F6Q8R0
ENSECAP00000006979 ENSECAP00000006979 9796.ENSECAP00000006979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]