SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007154 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007154
Domain Number 1 Region: 99-192
Classification Level Classification E-value
Superfamily Hormone receptor domain 2.75e-25
Family Hormone receptor domain 0.00083
Further Details:      
 
Domain Number 2 Region: 147-477
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000439
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007154   Gene: ENSECAG00000008888   Transcript: ENSECAT00000009405
Sequence length 587
Comment pep:known_by_projection chromosome:EquCab2:16:39928038:39953697:-1 gene:ENSECAG00000008888 transcript:ENSECAT00000009405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAARIAPGLALLLCCPVLSSAYALVDADDVMTKEEQIFLLHRAQAQCEKRLKEVQQKPA
NIMESDKGWASASTSGKPRKEKPSGKLYPESEEDKEDPRHRGRPCLPEWDHILCWPLGAP
GEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREV
FDRLGMIYTVGYSVSLASLTVAVLILAYFRRLHCTRNYIHMHLFLSFMLRAVSIFVKDAV
LYSGATLDEAERLTEEELRAIAQAPLPPAASAAGYVGCRVAVTFFLYFLATNYYWILVEG
LYLHSLIFMAFFSEKKYLWGFTVFGWGLPAIFVTVWVSVRATLANTGCWDLSSGNKKWII
QVPILASIVLNFILFINIVRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVHYIV
FMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLALDF
KRKARSGSSSYSYGPMVSHTSVTNVGPRTGLGLPLSPRLLPAATTNGHPQLPSHTKPGAP
ALQTTPPAVATPKDNGFLNGSCSGLDEEASVPERPPTLLQEEWETVM
Download sequence
Identical sequences F6Z5Y6
9796.ENSECAP00000007154 ENSECAP00000007154 ENSECAP00000007154 XP_005600804.1.31192 XP_008518539.1.77740 XP_014587199.1.31192 XP_014684300.1.49734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]