SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007367 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007367
Domain Number 1 Region: 131-308
Classification Level Classification E-value
Superfamily MIR domain 9.59e-51
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 995-1108
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.68e-18
Family SPRY domain 0.03
Further Details:      
 
Domain Number 3 Region: 3913-3991
Classification Level Classification E-value
Superfamily EF-hand 0.000000000663
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 4 Region: 573-721
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000594
Family SPRY domain 0.052
Further Details:      
 
Domain Number 5 Region: 15-96
Classification Level Classification E-value
Superfamily MIR domain 0.00000301
Family MIR domain 0.021
Further Details:      
 
Domain Number 6 Region: 335-462
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000183
Family IP3 receptor type 1 binding core, domain 2 0.02
Further Details:      
 
Domain Number 7 Region: 2060-2125
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000085
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000007367
Domain Number - Region: 1326-1447
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000241
Family SPRY domain 0.038
Further Details:      
 
Domain Number - Region: 2908-2965,3001-3072,3110-3236,3290-3315,3382-3387,3738-3832
Classification Level Classification E-value
Superfamily ARM repeat 0.0249
Family MIF4G domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007367   Gene: ENSECAG00000006795   Transcript: ENSECAT00000009645
Sequence length 4347
Comment pep:known_by_projection chromosome:EquCab2:1:73936064:74299190:-1 gene:ENSECAG00000006795 transcript:ENSECAT00000009645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSMQTAQGGSHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACW
WTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNGSLHVDAAFQQTLWSVAPISS
GSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLET
LRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKEKADVKSTAFTFRSSKEKLD
VGVRKEVDGMGTSEIKYGDSVCYIQHVNTGLWLTYQSVDVKSVRMGSIQRKAIMHHEGHM
DDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKAKASTVDLPIESVSLSLQDL
IGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAG
REAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVL
VESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPG
RDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWAS
TEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCL
DLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGY
APCYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPIPVDTSQIVLPPHLE
RIREKLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLET
LKTLLALGCHVGISDEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKL
AENAHNVWARDRVRQGWTYGIQQDVKNRRNPRLVPYALLDDRTKKSNKDSLREAVRTLLG
YGYNLEAPDQDHAARAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSR
PGCQPDQELGSDECAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNG
EILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPF
AVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSCPCLKVTQKSFGSQNSSTDI
MFYRLSMPIECAEVFSKTAGSGIPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRV
DKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDY
LMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHES
IKRSNCYMVCAGESMSPGQGRNNNGLEIGCVVDAASGLLTFTANGKELSTYYQVEPSTKL
FPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRM
PNQFLKVDVSRISERQGWLVQCMDPLQFMSLHIPEENRSVDILELTEQEELLKFHYHTLR
LYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARL
MMNSEFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLRPRMFSSPSFVSINNDCYQYSP
EFPLDILKAKTIQMLTEAVKQGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLK
HILQLIEPSVFKEAASPEEESEALEKEPCAEDSKLEGAGDEEAKEGERPKEGLLQMKLPE
PVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTAR
KTKEFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGN
SDLTIRGRLLSLVEKVTYLKKKQAEKPVESDSKKSSTLQQLISETMVRWAQESVIEDPEL
VRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEK
LMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFL
CYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREP
DLEKVVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANV
VVRLLIRRPECFGPALRGEGGNGLLAVMEEAIKIAEDPSRDGPSPTSGSSRTPDTEEEED
DTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIG
FQMPTIAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAA
ASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGC
SLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWK
YYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPD
YMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLAN
GWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMA
LYNRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLE
LESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQINGYVVSRGFKDLELDTPSIEK
RFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHR
LYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQT
LDARTVMKTGLESVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRNQPKGVTQIINYTTV
ALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECL
AAFAGAFPVAFLETHLDKHNIYSIYNTKSSRERAALNLPTNVEDVCPNIPSLEKLMEEIV
ELAESGIRYTQMPHVMEVILPMLCSYMSRWWEHGPENNPERTEMCCTALNSEHMNTLLGN
ILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDH
LKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEDLFRMV
AEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAVSDQERKKMKRKGDRY
SMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSMKDTEDEVRDIIRNNIHLQGKL
EDPAIRWQMALYKDLPNRTEDTSDPEKTVERVLDIANVLFHLEQKSTCMRRRYYNPGSTV
EHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYF
EDKLIEDLAKPGAEPPEEDEGTKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMA
KSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVA
ATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEG
LGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVD
YLLRVQESISDFYWYYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLA
HSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIG
KQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHK
HYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQ
TFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDV
VNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERSANKEESEKEKPEEQGPKMGFF
SILTVKSALFALRYNILTLMRMLSLKSLKKQMKKVKKMTVKDMVTAFFSSYWSILMSLLH
FVASVFRGFSRIICSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGEGEEGERKPVET
ALASEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPIPEVQ
DKFQEQKAKEEEKEEKEENKSEPEKAE
Download sequence
Identical sequences F6WZF4
ENSECAP00000007367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]