SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000007588 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000007588
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 4.97e-60
Family Dystroglycan, domain 2 0.000000302
Further Details:      
 
Domain Number 2 Region: 496-596
Classification Level Classification E-value
Superfamily Cadherin-like 8.16e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-19
Family Dystroglycan, N-terminal domain 0.00000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000007588   Gene: ENSECAG00000009665   Transcript: ENSECAT00000009899
Sequence length 894
Comment pep:known_by_projection chromosome:EquCab2:16:37621725:37679089:-1 gene:ENSECAG00000009665 transcript:ENSECAT00000009899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVSLSLLLPLWGRTFLLLLCVAVTQSRWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASNGEVIKVSAAGKEALPSWLHWDSESHTLEGL
PLDTDKGVHYISVSAARLGANGSHIPQASSVFSIEVYPEDHSEPQSLRAASPDPGDVVSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVSGQIRPTMTIPGYVEPTAVVTPP
TTTTKKPRVSTPKSATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRI
RTTTSGVPRGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLR
EQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQG
DKAPARFKAKFVGDPAPVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWTN
NTLPLEPCPKEQITGLSRRIAEDDGKPRAAFLNALEPDFKAMSIAVTGSGSCRHLQFIPV
APPKKVPSEAPPTEVPARDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKG
KLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTP
LNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences F6X9U4
ENSECAP00000007588 ENSECAP00000007588 XP_001497663.1.31192 XP_005600719.1.31192 XP_005600720.1.31192 XP_005600721.1.31192 9796.ENSECAP00000007588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]