SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008065 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008065
Domain Number 1 Region: 536-636
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-23
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008065   Gene: ENSECAG00000010158   Transcript: ENSECAT00000010452
Sequence length 641
Comment pep:known_by_projection chromosome:EquCab2:10:14493414:14513771:-1 gene:ENSECAG00000010158 transcript:ENSECAT00000010452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPSSPEKGTQPPSVPECDAEVRPQGAAQSREHPEDPREQEAPEAPAERPSGRGAEQQA
EEEEEVGEGSSTESSRDAGEGHGGTQKDTQTQADDRHRETDLAMQRQKTDTGLEGPSPGK
QEERLREIREREREYKSAMEVEVALLRGELAGERVAARREEDKLRDLLGQRVDTEQGAQE
QREQEQRRLSQERARVEGLRRKLQEAQGQLESQPEDQRERLMQGVHEMREQLDVAQRAYE
DLEFQQLERESRREEEDRDSPGTRALDPEARELQASVAQHRRRIQVLEEQLKSLGEQMAA
ESRGLSRKKEEALQALTQERSRLLELNHLQGIPGGDFSEPNQALTKLLFTQKTDRRLLVL
QDPTTHTATAASSCLLSVHSSLQGSIGLQRTGSLPRKRGDRASQRGSPRPLSFHCTGPLE
ASALPPAAADSRRHPLYQLLNCGPGNSCGAVHPDIARMERLLQQAMAERERLLKARPGHS
RPHWGPFSPPLPLLCIPPAFPDSPPPRPKVLDLRQHLERWGHNPENCPHVGVSGGCCRGP
LVKMGGRIKTWRKRWFCFDQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCAFKSPN
PRLTFCVKTYERLFYMVAPSPEAMRIWMDVIVTAADENHAP
Download sequence
Identical sequences F6R643
ENSECAP00000008065 ENSECAP00000008065 9796.ENSECAP00000008065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]