SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000008926 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000008926
Domain Number 1 Region: 219-488
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.92e-78
Family Protein kinases, catalytic subunit 0.00000024
Further Details:      
 
Domain Number 2 Region: 127-262
Classification Level Classification E-value
Superfamily SH2 domain 1.21e-36
Family SH2 domain 0.00019
Further Details:      
 
Domain Number 3 Region: 68-150
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000109
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000008926   Gene: ENSECAG00000010972   Transcript: ENSECAT00000011418
Sequence length 504
Comment pep:known_by_projection chromosome:EquCab2:22:49296815:49304560:-1 gene:ENSECAG00000010972 transcript:ENSECAT00000011418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRPAPGPEHMEPFLRKRLTFLSFFWDKIWPAGAPDDSMPRFPDAGTDAEPEPPAAEPRS
PPARAQLFRALYDFTARCAAELSVRRGDRLYALKEDGHYIFARRLSGPPSAGLVPVAYVA
KATPETLSDQPWYFSGISRTEAQQLLLSPANAPGAFLVRPSESSHGDYSLSVRAQAKVRH
YRISTAADGGLYLQKGRLFSSLEELLTYYKANWKLIQNPLLQPCVPQQPPRQDEWERPHS
EFTLRRRLGEGYFGEVWEGVWRGSVPVAVKVIRSADMKLADLAKEIQTLKSLRHERLIRL
HAVCSTGEPVYIVTELMRKGNLQAFLGSPEGQALSPPLLLSCARQVAEGMSYLEERRIVH
RDLAARNVLVGDDLACKVADFGLARLLKDDIYSPSSGSKIPVKWTAPEAANYRIFSQKSD
VWSFGVLLYEVFSYGQCPYEGMSNHETLQQIMRGYRLPRPAACPAEVYLLMLECWQDSPE
ERPAFAVLQEKLGAICSCLHPALM
Download sequence
Identical sequences F7C2C5
ENSECAP00000008926 9796.ENSECAP00000008926 ENSECAP00000008926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]