SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009413 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009413
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-35
Family SCAN domain 0.0000636
Further Details:      
 
Domain Number 2 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 797-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 4 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.2e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 601-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 909-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 853-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 462-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 657-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 10 Region: 741-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 211-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 12 Region: 950-1000
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000337
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 13 Region: 365-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000927
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 564-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000136
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 15 Region: 704-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000193
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009413   Gene: ENSECAG00000011611   Transcript: ENSECAT00000011979
Sequence length 1027
Comment pep:known_by_projection chromosome:EquCab2:16:41802803:41824664:-1 gene:ENSECAG00000011611 transcript:ENSECAT00000011979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRRLRYHETSGPQEAL
TRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGSGEEAVALVEEL
QKDLDGPALKVPVLVQDQDTLQEQMSTPGTALPHAPTGSHISAEMHPNPLTNPVVFNLQD
PQHDSPAHEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMTENEEVTSKSSISQRADSQKGTSKRLQGGVPQVLNFEEE
CEWQVSANQWRNETRERDTLKKVSFCEQDKKKRTPPEKRSQKWKEFGESLNLGSALSESL
IDTEGKKCHKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNHS
GEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERP
YKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCD
ECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGK
VFNCKSNLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFIL
KKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKSF
MVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRHTGEKPFECGECGRAFSSNRNLIEHKR
IHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIHTG
EKPYACSECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEKPY
KCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGCND
CSKVFRQRKNLAVHQKIHTDEKLCECDESEKEFSQSSNLRLQHKIHTVEEFSWLQNANES
KIEIQKI
Download sequence
Identical sequences F7BMA7
9796.ENSECAP00000009413 ENSECAP00000009413 ENSECAP00000009413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]