SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009477 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009477
Domain Number 1 Region: 100-304
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-51
Family DBL homology domain (DH-domain) 0.000000305
Further Details:      
 
Domain Number 2 Region: 291-453
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 580-681,730-756
Classification Level Classification E-value
Superfamily SH2 domain 2.59e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 500-611
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000231
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 5 Region: 4-138
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000035
Family Calponin-homology domain, CH-domain 0.039
Further Details:      
 
Domain Number 6 Region: 696-745
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000182
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009477   Gene: ENSECAG00000011099   Transcript: ENSECAT00000012045
Sequence length 760
Comment pep:known_by_projection chromosome:EquCab2:5:59763348:60114171:1 gene:ENSECAG00000011099 transcript:ENSECAT00000012045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTEESVDDEDIYKGLPDL
IDETRVEDEEGLYDCVYGEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKY
TETLESIEKYFMAPLKRFLTAAEFDSVFINIPELVKVHRNLMQEIHDSIVNKNDQNLYQV
FINYKERLVIYGQYCSGVESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVP
MQRVLKYHLLLQELVKHTTDPVEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLS
IENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDL
QQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPD
YADSNFHEFKMHTFSRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDSCGRLNS
SEQGTLKPSEKRTNGLRRTPRQVDPGLPKMQVIKNYTGTPPPALHEGPPLHIQAGDTVEL
LRGDAHSLFWQGRNLASGEVGFFPSDAVKPSPCVPKPVDYSCQPWYAGAMERLQAETELI
NRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYK
HHSLKEGFRTLDTTLQFPYKEPEHSAGQRGHRAGISFLSPKVLGIAIARYDFCARDMREL
SLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
Download sequence
Identical sequences F7BA56
9796.ENSECAP00000009477 ENSECAP00000009477 ENSECAP00000009477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]