SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009647 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009647
Domain Number 1 Region: 1055-1275
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.67e-81
Family Fibrinogen C-terminal domain-like 0.00000172
Further Details:      
 
Domain Number 2 Region: 707-867
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-22
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 3 Region: 531-691
Classification Level Classification E-value
Superfamily Fibronectin type III 2.12e-21
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 4 Region: 881-961
Classification Level Classification E-value
Superfamily Fibronectin type III 3.93e-18
Family Fibronectin type III 0.00078
Further Details:      
 
Domain Number 5 Region: 357-515
Classification Level Classification E-value
Superfamily Fibronectin type III 4.09e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 6 Region: 971-1056
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000476
Family Fibronectin type III 0.00084
Further Details:      
 
Domain Number 7 Region: 263-348
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000202
Family Fibronectin type III 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSECAP00000009647
Domain Number - Region: 236-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family Integrin beta EGF-like domains 0.063
Further Details:      
 
Domain Number - Region: 173-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00123
Family Integrin beta EGF-like domains 0.038
Further Details:      
 
Domain Number - Region: 204-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0106
Family Integrin beta EGF-like domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009647   Gene: ENSECAG00000011669   Transcript: ENSECAT00000012232
Sequence length 1296
Comment pep:known_by_projection chromosome:EquCab2:5:10516753:10571399:1 gene:ENSECAG00000011669 transcript:ENSECAT00000012232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLHGIFSFPLGLLFGSVLLVASAPAALEPHGCSDKEQQVTFSHTYKIDVPKSALVQVEA
NPQPLSDDGASLLVPGEAEEHNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMAE
VKEQCSARCCCQGAAGVSGHCSSHGTFSPETCSCLCEQGWEGAACDRPACPGACSGHGRC
VDGRCVCDEPYVGADCAYPACPENCSGHGVCVRGVCQCHEDFTSEDCSERRCPGDCSGHG
FCDTGECYCEEGFTGLDCSQVVAPQGLQLLKSTEDSLLVNWEPSSEVDHYLLSYYQLGKE
LSGKQIQVPKEQHTYEITGLQPGTKYIVSLRNVKKEISSSPQHLLATTDLAVLGTAWVTD
ETENSLDVEWENPPTEVDYYKLRYGPLTGQEVAEVTVPKSSDPKSRYDITGLQPGTEYKI
TVVPMRGDLEGKSILLNGRTEIDSPTNVVTHQVTEDTAMVSWDPVQAVIDKYVVRHISAD
GESKDMAVPREQSSTILTGLKPGEAYKVYVWAEKGSQESKKADTEALTEIDSPTNLVTDL
VTENMATVSWDPVQADIDRYMVRYTSADGDTKDVPVGKEQNSTILTGLRPGVEYTVHVWA
EKGDRESKKADTKAPTEIDSPQNLVTDRVTENTATISWDPVQADIDRYMVRYTSADGDTK
DVPVRKEQNSTILTGLRPGVEYKVHVWAEKGDRESKKADTKAPTDIDSPKNLVTDLVTEN
TATVSWDPVQAVIDRYMVRYTSADGDTKDVPVGKEQNSTILTGLRPGVEYKVYVWAEKGD
QESKKADTKAPTEIDSPQNLVTNQVTENTATVSWDPVQADIDRYMVRYTSADGDTKDVPV
GKEQNSTILTGLRPGVEYTVHVWAKKGDQESKKADTKAPTDIDSPKNLVTDRVTENTATI
SWDPVQADIDRYVVRYTSADGDAREVPVGKEQSSTILTGLRPGVEYKVHVWAEKGDWESK
KADTKALPDIDPPKNLRSSAVTQSGGVLTWTPPTAQIDGYILTYQFPNGAVKEVQLGQGD
QRFELQGLEQGVAYPVSLVAFKGDRRSRNVSTILSTVGARFPHPSDCSQVQQNSNVASGV
YTIYLHGDASRPLQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRAYVEGFGDPMKEFWLG
LDKLHNLTTGTPTRYEVRVDLQTANESAYAIYDFFQVASSKERFKLTVGKYRGTAGDALS
YHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPWKGH
EFSIPYVELKIRPHGYSGEHVLNRKKRTLGGKTRTV
Download sequence
Identical sequences F6ZWJ9
ENSECAP00000009647 ENSECAP00000009647 9796.ENSECAP00000009647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]