SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009881 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009881
Domain Number 1 Region: 373-537
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-25
Family Toll/Interleukin receptor TIR domain 0.0037
Further Details:      
 
Domain Number 2 Region: 35-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000279
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 135-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000333
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 228-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000121
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009881   Gene: ENSECAG00000011940   Transcript: ENSECAT00000012506
Sequence length 571
Comment pep:known_by_projection chromosome:EquCab2:15:7406789:7452645:-1 gene:ENSECAG00000011940 transcript:ENSECAT00000012506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGMLLLLLCGMSIALPPFIRADACRNISMLHETPSAGQPFAFNCTYPPLTFRNVYVTWYK
HPSKIPISKNIQSRIHQDQNWILFLPTWEDSGIYHCVINDTNTCHSIHVNLTVFKKYWCS
ASRNSQPNLLDEYKQILHAGNDDSLTCHLNFPRSCVLDSIKWYKDCKEIKGERFTSVGKK
LSVNNVSAEDRGNYACQATLTHTGRQYTVLNRITVNIKKVGNGRRIPKIIYPKNNSIEVQ
LGSTLIVDCNITDTKDNTNLRCWRVNNTSVDIYYSASRRIQEGIENETSFQDHKFYTVNI
TFLEVKMEDYGHPFTCHAGVSAAYFVLKLPVPDFRAYLIGGLVALTGVVVSVLCIYNIFK
IDIVLWYRSAFHSTGTIEDGKLYDAYVLYPRPQGESQSHDVDTLVLKILPEVLERQCGYK
LFIFGRDEFPGQAVANVIDENIKLCRRLIIIIVPESLSFDLLKNMSEEQIAVYNALLQDG
MKVILIELEKVEDYTSMPESIQYIKQKHGAIQWSGAFTEQSQCAKTKFWKKVRYHMPPKR
YRPLSPVQLLKRTPCDLTAGTWEASVGFITP
Download sequence
Identical sequences F6VEC0
9796.ENSECAP00000009881 ENSECAP00000009881 ENSECAP00000009881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]