SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009909 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSECAP00000009909
Domain Number - Region: 408-462
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0628
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009909   Gene: ENSECAG00000011899   Transcript: ENSECAT00000012541
Sequence length 658
Comment pep:known_by_projection chromosome:EquCab2:1:175088043:175093369:1 gene:ENSECAG00000011899 transcript:ENSECAT00000012541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATSK
ERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQA
EEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPHL
FYIPGRMCQITTLNFLNDGKFYTSLFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRNE
EQKAEQEEGKVAQREEELEETGNQHNDVEIEEPGEEEEKEIGIVHSDVEKEQEEEEQKQE
MEVKMEEETEVRESEKQQDSQPEEVMDVLEMVESVKNVIAEQEVMETNQVESVEPSENET
SKELEPEMEFEVEPDKECKSLSPVKENASALEMENEPEEKEEKESEPQPEPVAQPQPLPQ
PPPPPPSQSQPQPVLQPHPLSQPETLPLAVFQPPPQVIQEQGHLLPERKEFPLESVKLTE
VTVEPVLTVHPESKTKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSSSSG
SSSSRSSSSSSSSTSGSSSRDSSSSTTSSSESRSRSRGRGHNRDRKHRRSVDRKRRDTSG
LERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDKRR
Download sequence
Identical sequences F6TER4
9796.ENSECAP00000009909 ENSECAP00000009909 ENSECAP00000009909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]