SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000009970 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000009970
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-76
Family BAR domain 0.0000000622
Further Details:      
 
Domain Number 2 Region: 297-362
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-19
Family SH3-domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000009970   Gene: ENSECAG00000012008   Transcript: ENSECAT00000012619
Sequence length 367
Comment pep:known_by_projection chromosome:EquCab2:1:91197583:91326887:-1 gene:ENSECAG00000012008 transcript:ENSECAT00000012619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRGPAERRDHPARPGAVAMSMAGLKKQFHKASQLFSEKISGVEGTKLDDEFLDMERK
IDVTNKAVAEILSKATEYLQPNPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLK
YGKELGEASTFGDALIEVGESMKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLK
KLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAAFI
EAALDYHKQSTEILQELHSKLQIRITAASNLPKREYKPRPIKRSPSELNGVSATSSTKTT
GSNVPMDQPCCRGLYDFEPNQGELGFKEGDVITLTNQIDENWYEGMLHGESGFFPINYVE
VIVPLPQ
Download sequence
Identical sequences F6T6C4
ENSECAP00000009970 ENSECAP00000009970 9796.ENSECAP00000009970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]