SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSECAP00000010126 from Equus caballus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSECAP00000010126
Domain Number 1 Region: 66-150
Classification Level Classification E-value
Superfamily E set domains 0.00000000175
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSECAP00000010126   Gene: ENSECAG00000012359   Transcript: ENSECAT00000012813
Sequence length 515
Comment pep:known_by_projection chromosome:EquCab2:7:22883247:22889270:-1 gene:ENSECAG00000012359 transcript:ENSECAT00000012813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFQLWTTLKLPISLHHWNYFTNSLCPDASLNPVVSLAETELRIKKIMEELDQLVPPRPFT
HMNTTTSAAHSRATLLNPQDTYCKGDQLDILLQVRDHLGRRKEYGGDFLRARMSSPALQA
GASGKVTDFNNGTYLVSFTLFWEGQVSLSLLLIHPSEGVSALWRARNQGYDKVIFTGQFA
SGTSHVNTDCALLLNSSAELCQYLDAQDQEAFYCVKPPQAPCAALTHMYSKNKEVSYLSE
QERSLFERSNVGVEIMENFDAISVSQCNKKRVPTKKKCKFGMTSTIPSGHVWKDTWNPVS
CSLAPIKMKECLRGKFIHLMGDSTIRQWMEYFKSSINTLKSVDLHELGKFQNLLAVDLDK
NINIQWQKHGYPLIGSLIYSVKDIEYLARVIDRTGGEKNTIIVISLGQHFRPFPIDVFIR
RALNVHKAVQRLLLRSPDTMVIIKAENIRDMDADMERFSDFHGYIQYLVIKDIFQDLNVG
IIDAWDMTIAYGTNNVHPPQSVVRNQINILLNYIC
Download sequence
Identical sequences F6REV5
9796.ENSECAP00000010126 ENSECAP00000010126 ENSECAP00000010126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]